Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1998
Gene name
LocationContig_191:20532..21234
Strand-
Gene length (bp)702
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 3.9E-33 1 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32232|CBS_RAT Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3 1 232 9.0E-87
sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=1 SV=3 1 232 2.0E-85
sp|P35520|CBS_HUMAN Cystathionine beta-synthase OS=Homo sapiens GN=CBS PE=1 SV=2 1 232 7.0E-85
sp|Q58H57|CBS_MACFA Cystathionine beta-synthase OS=Macaca fascicularis GN=CBS PE=2 SV=3 1 232 4.0E-84
sp|P32582|CBS_YEAST Cystathionine beta-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS4 PE=1 SV=1 1 231 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32232|CBS_RAT Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3 1 232 9.0E-87
sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=1 SV=3 1 232 2.0E-85
sp|P35520|CBS_HUMAN Cystathionine beta-synthase OS=Homo sapiens GN=CBS PE=1 SV=2 1 232 7.0E-85
sp|Q58H57|CBS_MACFA Cystathionine beta-synthase OS=Macaca fascicularis GN=CBS PE=2 SV=3 1 232 4.0E-84
sp|P32582|CBS_YEAST Cystathionine beta-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS4 PE=1 SV=1 1 231 1.0E-80
sp|P46794|CBS_DICDI Cystathionine beta-synthase OS=Dictyostelium discoideum GN=cysB PE=2 SV=2 1 232 8.0E-80
sp|Q9N0V7|CBS_RABIT Cystathionine beta-synthase OS=Oryctolagus cuniculus GN=CBS PE=2 SV=3 1 232 1.0E-77
sp|P9WP51|Y1077_MYCTU Putative cystathionine beta-synthase Rv1077 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cbs PE=1 SV=1 3 232 2.0E-34
sp|P9WP50|Y1077_MYCTO Putative cystathionine beta-synthase MT1108 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cbs PE=3 SV=1 3 232 2.0E-34
sp|Q8CMT6|CYSK_STAES Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysK PE=3 SV=1 1 218 4.0E-34
sp|Q5HRP1|CYSK_STAEQ Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysK PE=3 SV=1 1 218 4.0E-34
sp|P63872|CYSK_STAAW Cysteine synthase OS=Staphylococcus aureus (strain MW2) GN=cysK PE=3 SV=1 1 218 9.0E-33
sp|Q6GBX5|CYSK_STAAS Cysteine synthase OS=Staphylococcus aureus (strain MSSA476) GN=cysK PE=3 SV=1 1 218 9.0E-33
sp|Q6GJF8|CYSK_STAAR Cysteine synthase OS=Staphylococcus aureus (strain MRSA252) GN=cysK PE=3 SV=1 1 218 9.0E-33
sp|P63871|CYSK_STAAN Cysteine synthase OS=Staphylococcus aureus (strain N315) GN=cysK PE=1 SV=1 1 218 9.0E-33
sp|P63870|CYSK_STAAM Cysteine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysK PE=3 SV=1 1 218 9.0E-33
sp|Q5HIG2|CYSK_STAAC Cysteine synthase OS=Staphylococcus aureus (strain COL) GN=cysK PE=3 SV=1 1 218 9.0E-33
sp|O01592|CYSK3_CAEEL Cysteine synthase 3 OS=Caenorhabditis elegans GN=cysl-3 PE=1 SV=1 1 197 3.0E-32
sp|Q44004|SBNA_CUPMC Putative siderophore biosynthesis protein SbnA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=sbnA PE=3 SV=2 4 227 6.0E-32
sp|P56067|CYSM_HELPY Cysteine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cysM PE=1 SV=1 1 219 6.0E-32
sp|P0ABK5|CYSK_ECOLI Cysteine synthase A OS=Escherichia coli (strain K12) GN=cysK PE=1 SV=2 1 228 2.0E-31
sp|P0ABK6|CYSK_ECO57 Cysteine synthase A OS=Escherichia coli O157:H7 GN=cysK PE=3 SV=2 1 228 2.0E-31
sp|O05393|MCCA_BACSU O-acetylserine dependent cystathionine beta-synthase OS=Bacillus subtilis (strain 168) GN=mccA PE=1 SV=1 3 219 2.0E-31
sp|P9WP55|CYSK_MYCTU O-acetylserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysK1 PE=1 SV=1 1 218 3.0E-31
sp|P9WP54|CYSK_MYCTO O-acetylserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysK1 PE=3 SV=1 1 218 3.0E-31
sp|P0A535|CYSK_MYCBO O-acetylserine sulfhydrylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysK PE=3 SV=1 1 218 3.0E-31
sp|O45679|CYSK2_CAEEL Bifunctional L-3-cyanoalanine synthase/cysteine synthase OS=Caenorhabditis elegans GN=cysl-2 PE=1 SV=1 1 218 6.0E-31
sp|P73410|CYSK_SYNY3 Cysteine synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysK PE=3 SV=2 1 218 3.0E-30
sp|Q7DDL5|CYSK_NEIMB Cysteine synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysK PE=1 SV=1 1 218 4.0E-30
sp|P0A1E3|CYSK_SALTY Cysteine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysK PE=1 SV=2 1 228 5.0E-30
sp|P0A1E4|CYSK_SALTI Cysteine synthase A OS=Salmonella typhi GN=cysK PE=3 SV=2 1 228 5.0E-30
sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 1 228 4.0E-29
sp|O32978|CYSK_MYCLE O-acetylserine sulfhydrylase OS=Mycobacterium leprae (strain TN) GN=cysK PE=3 SV=1 1 221 1.0E-28
sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 1 228 2.0E-28
sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 1 228 2.0E-28
sp|P71128|CYSM_CAMJE Cysteine synthase B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysM PE=3 SV=2 1 218 2.0E-28
sp|Q93244|CYSK1_CAEEL Cysteine synthase 1 OS=Caenorhabditis elegans GN=cysl-1 PE=1 SV=2 1 218 4.0E-27
sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 1 228 6.0E-27
sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 1 228 7.0E-27
sp|Q59966|CYSK_SYNE7 Cysteine synthase OS=Synechococcus elongatus (strain PCC 7942) GN=srpG PE=2 SV=1 1 231 3.0E-26
sp|Q9S6Z7|CYSD1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 OS=Arabidopsis thaliana GN=CYSD1 PE=1 SV=1 1 233 3.0E-26
sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 1 228 5.0E-26
sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 1 228 8.0E-26
sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 1 218 9.0E-26
sp|Q5XAQ3|CYSK_STRP6 Cysteine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysK PE=1 SV=3 1 223 1.0E-25
sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 1 229 2.0E-25
sp|Q9ZMW6|CYSM_HELPJ Cysteine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cysM PE=3 SV=1 1 219 3.0E-25
sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 1 224 3.0E-25
sp|Q8XSQ0|SBNA_RALSO Putative siderophore biosynthesis protein SbnA OS=Ralstonia solanacearum (strain GMI1000) GN=sbnA PE=3 SV=1 4 227 5.0E-25
sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 1 228 8.0E-25
sp|P87131|CYSK2_SCHPO Cysteine synthase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys12 PE=3 SV=1 1 233 2.0E-24
sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 1 218 3.0E-24
sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 1 228 3.0E-24
sp|P55708|Y4XP_RHISN Putative cysteine synthase OS=Rhizobium sp. (strain NGR234) GN=NGR_a00730 PE=3 SV=1 8 232 3.0E-24
sp|P47998|CYSK1_ARATH Cysteine synthase 1 OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 1 228 4.0E-24
sp|Q43153|CYSC_SPIOL Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial OS=Spinacia oleracea GN=CYSC PE=1 SV=1 1 218 9.0E-24
sp|P16703|CYSM_ECOLI Cysteine synthase B OS=Escherichia coli (strain K12) GN=cysM PE=1 SV=1 1 221 1.0E-23
sp|P57171|CYSK_BUCAI Cysteine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysK PE=3 SV=1 1 218 1.0E-23
sp|P31300|CYSKP_CAPAN Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1 1 228 1.0E-23
sp|Q59447|CYSK_FLAS3 Cysteine synthase OS=Flavobacterium sp. (strain K3-15 / DSM ID92-509) GN=cysK PE=3 SV=1 1 178 9.0E-23
sp|Q7A1Z6|SBNA_STAAW Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MW2) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|A8YZ41|SBNA_STAAT Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|Q6GD09|SBNA_STAAS Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MSSA476) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|Q6GKI9|SBNA_STAAR Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA252) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|Q932K9|SBNA_STAAM Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|A6QDA0|SBNA_STAAE Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Newman) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|D0K799|SBNA_STAAD Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain ED98) GN=sbnA PE=3 SV=2 4 226 9.0E-23
sp|Q5HJQ3|SBNA_STAAC Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain COL) GN=sbnA PE=3 SV=2 4 226 9.0E-23
sp|A5INY7|SBNA_STAA9 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH9) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|Q2G1N3|SBNA_STAA8 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain NCTC 8325) GN=sbnA PE=2 SV=2 4 226 9.0E-23
sp|D2N3G7|SBNA_STAA5 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain MRSA ST398 / isolate S0385) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|D3ERF5|SBNA_STAA4 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain 04-02981) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|Q2FKE3|SBNA_STAA3 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain USA300) GN=sbnA PE=3 SV=2 4 226 9.0E-23
sp|A6TXQ1|SBNA_STAA2 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain JH1) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|A7WX68|SBNA_STAA1 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|D1GUM7|SBNA_STAA0 Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain TW20 / 0582) GN=sbnA PE=3 SV=1 4 226 9.0E-23
sp|P29848|CYSM_SALTY Cysteine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysM PE=1 SV=1 1 221 1.0E-22
sp|Q99X99|SBNA_STAAN Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain N315) GN=sbnA PE=3 SV=1 4 226 2.0E-22
sp|Q2YUU0|SBNA_STAAB Probable siderophore biosynthesis protein SbnA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sbnA PE=3 SV=1 4 226 2.0E-22
sp|P45040|CYSK_HAEIN Cysteine synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysK PE=1 SV=1 1 218 3.0E-22
sp|Q1KLZ2|CAS1_MALDO L-3-cyanoalanine synthase 1, mitochondrial OS=Malus domestica GN=CAS1 PE=1 SV=1 1 218 4.0E-21
sp|O67507|CYSM_AQUAE Cysteine synthase OS=Aquifex aeolicus (strain VF5) GN=cysM PE=3 SV=1 1 218 5.0E-21
sp|Q59918|CYSK_STAHA Cysteine synthase (Fragment) OS=Staphylococcus haemolyticus GN=cysK PE=3 SV=1 65 218 6.0E-21
sp|O34476|CYSM_BACSU Probable cysteine synthase OS=Bacillus subtilis (strain 168) GN=ytkP PE=3 SV=1 1 225 2.0E-20
sp|O59701|CYSK1_SCHPO Cysteine synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys11 PE=3 SV=1 1 226 2.0E-20
sp|P50867|CYSK_EMENI Cysteine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysB PE=3 SV=2 1 231 2.0E-20
sp|Q9I526|CYSM_PSEAE Cysteine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysM PE=3 SV=1 1 223 3.0E-20
sp|P37887|CYSK_BACSU Cysteine synthase OS=Bacillus subtilis (strain 168) GN=cysK PE=1 SV=3 1 189 4.0E-20
sp|Q54CN7|CYSK_DICDI Cysteine synthase OS=Dictyostelium discoideum GN=cysK PE=3 SV=1 3 231 6.0E-20
sp|Q76MX2|CAS1_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial OS=Solanum tuberosum GN=PCAS-1 PE=1 SV=1 1 218 1.0E-19
sp|Q1KLZ1|CAS2_MALDO L-3-cyanoalanine synthase 2, mitochondrial OS=Malus domestica GN=CAS2 PE=1 SV=1 1 229 1.0E-19
sp|Q9SXS7|CYSD2_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase D2 OS=Arabidopsis thaliana GN=CYSD2 PE=1 SV=1 1 233 9.0E-19
sp|Q8KA48|CYSK_BUCAP Cysteine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysK PE=3 SV=1 1 231 5.0E-18
sp|Q9S757|CYSC1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial OS=Arabidopsis thaliana GN=CYSC1 PE=1 SV=1 1 228 6.0E-18
sp|F4K5T2|CGL_ARATH Bifunctional cystathionine gamma-lyase/cysteine synthase OS=Arabidopsis thaliana GN=DES1 PE=1 SV=1 1 233 1.0E-17
sp|Q9FS29|CAS2_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial OS=Solanum tuberosum GN=PCAS-2 PE=1 SV=1 1 218 2.0E-15
sp|O22682|CYSK4_ARATH Probable S-sulfocysteine synthase, chloroplastic OS=Arabidopsis thaliana GN=At3g03630 PE=1 SV=1 1 218 1.0E-14
sp|D2Z027|DCSD_STRLA O-ureido-L-serine synthase OS=Streptomyces lavendulae GN=dcsD PE=1 SV=1 54 226 2.0E-13
sp|Q9LJA0|CYSK2_ARATH Putative inactive cysteine synthase 2 OS=Arabidopsis thaliana GN=OASA2 PE=5 SV=2 1 92 1.0E-12
sp|Q79FV4|Y848_MYCTU Uncharacterized pyridoxal phosphate-dependent protein CysK2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysK2 PE=3 SV=1 41 232 3.0E-11
sp|P53206|CYSK_YEAST Putative cysteine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR012W PE=1 SV=1 1 220 2.0E-09
sp|P9WP53|CYSM_MYCTU O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysM PE=1 SV=1 1 185 4.0E-08
sp|P9WP52|CYSM_MYCTO O-phosphoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysM PE=3 SV=1 1 185 4.0E-08
sp|P63874|CYSM_MYCBO O-phosphoserine sulfhydrylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysM PE=3 SV=1 1 185 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1998
MSEKMSQEKLRILKSLGAEVIRTPTGAPVDSPNSTISVARRLQSQRPNSHILDQHTNPSNPLCHELGTAREIWEQ
CDGKVDVVIAGAGTGGTVTGLSRGMRKYNSKILVVGVDAVGSILAQPEELNQHSGDYKLEGIGYDFVPDVLDRNT
VDAWIKSTDDSAFRYARRLIREEGLLCGGSSGAAVAAVVDLLKARPELNREDVRIVVILPDGIRNYLSKFVDDSW
MTENGFLP*
Coding >Ophun1|1998
ATGTCGGAAAAGATGTCACAAGAAAAGTTGCGGATCCTCAAATCGCTAGGGGCTGAGGTCATTCGAACGCCAACC
GGGGCCCCAGTTGATTCTCCCAATTCTACCATCAGCGTCGCCCGGAGATTGCAAAGCCAGCGGCCGAACTCTCAT
ATTCTCGACCAGCACACAAACCCAAGCAATCCTCTTTGTCATGAGCTTGGGACAGCAAGAGAGATATGGGAGCAA
TGTGACGGCAAAGTCGATGTCGTCATTGCTGGGGCCGGAACTGGAGGAACGGTGACTGGACTTTCCAGGGGCATG
CGAAAGTACAATTCTAAAATCCTTGTGGTTGGCGTTGATGCTGTCGGATCGATACTCGCCCAACCGGAAGAGCTG
AACCAGCACAGCGGAGACTACAAACTCGAAGGGATTGGCTACGACTTTGTCCCGGACGTTCTCGACCGGAACACG
GTAGACGCCTGGATCAAGAGCACCGACGACTCAGCATTTCGCTACGCGCGGCGGTTGATCCGGGAAGAGGGACTA
CTCTGTGGCGGCTCTTCCGGTGCTGCTGTGGCGGCTGTGGTGGACCTCTTGAAAGCTCGACCTGAGCTCAACCGT
GAGGACGTCCGCATTGTGGTGATTCTGCCAGACGGTATCAGGAACTACCTATCCAAGTTTGTTGACGATTCCTGG
ATGACGGAAAACGGCTTTTTGCCTTGA
Transcript >Ophun1|1998
ATGTCGGAAAAGATGTCACAAGAAAAGTTGCGGATCCTCAAATCGCTAGGGGCTGAGGTCATTCGAACGCCAACC
GGGGCCCCAGTTGATTCTCCCAATTCTACCATCAGCGTCGCCCGGAGATTGCAAAGCCAGCGGCCGAACTCTCAT
ATTCTCGACCAGCACACAAACCCAAGCAATCCTCTTTGTCATGAGCTTGGGACAGCAAGAGAGATATGGGAGCAA
TGTGACGGCAAAGTCGATGTCGTCATTGCTGGGGCCGGAACTGGAGGAACGGTGACTGGACTTTCCAGGGGCATG
CGAAAGTACAATTCTAAAATCCTTGTGGTTGGCGTTGATGCTGTCGGATCGATACTCGCCCAACCGGAAGAGCTG
AACCAGCACAGCGGAGACTACAAACTCGAAGGGATTGGCTACGACTTTGTCCCGGACGTTCTCGACCGGAACACG
GTAGACGCCTGGATCAAGAGCACCGACGACTCAGCATTTCGCTACGCGCGGCGGTTGATCCGGGAAGAGGGACTA
CTCTGTGGCGGCTCTTCCGGTGCTGCTGTGGCGGCTGTGGTGGACCTCTTGAAAGCTCGACCTGAGCTCAACCGT
GAGGACGTCCGCATTGTGGTGATTCTGCCAGACGGTATCAGGAACTACCTATCCAAGTTTGTTGACGATTCCTGG
ATGACGGAAAACGGCTTTTTGCCTTGA
Gene >Ophun1|1998
ATGTCGGAAAAGATGTCACAAGAAAAGTTGCGGATCCTCAAATCGCTAGGGGCTGAGGTCATTCGAACGCCAACC
GGGGCCCCAGTTGATTCTCCCAATTCTACCATCAGCGTCGCCCGGAGATTGCAAAGCCAGCGGCCGAACTCTCAT
ATTCTCGACCAGCACACAAACCCAAGCAATCCTCTTTGTCATGAGCTTGGGACAGCAAGAGAGATATGGGAGCAA
TGTGACGGCAAAGTCGATGTCGTCATTGCTGGGGCCGGAACTGGAGGAACGGTGACTGGACTTTCCAGGGGCATG
CGAAAGTACAATTCTAAAATCCTTGTGGTTGGCGTTGATGCTGTCGGATCGATACTCGCCCAACCGGAAGAGCTG
AACCAGCACAGCGGAGACTACAAACTCGAAGGGATTGGCTACGACTTTGTCCCGGACGTTCTCGACCGGAACACG
GTAGACGCCTGGATCAAGAGCACCGACGACTCAGCATTTCGCTACGCGCGGCGGTTGATCCGGGAAGAGGGACTA
CTCTGTGGCGGCTCTTCCGGTGCTGCTGTGGCGGCTGTGGTGGACCTCTTGAAAGCTCGACCTGAGCTCAACCGT
GAGGACGTCCGCATTGTGGTGATTCTGCCAGACGGTATCAGGAACTACCTATCCAAGTTTGTTGACGATTCCTGG
ATGACGGAAAACGGCTTTTTGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail