Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1994
Gene name
LocationContig_191:6528..8539
Strand-
Gene length (bp)2011
Transcript length (bp)1947
Coding sequence length (bp)1947
Protein length (aa) 649

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 5.6E-146 169 598
PF14558 TRP_N ML-like domain 3.7E-37 23 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 20 646 5.0E-133
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 14 647 9.0E-126
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 5 620 5.0E-125
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 16 609 1.0E-106
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 20 596 1.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 20 646 5.0E-133
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 14 647 9.0E-126
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 5 620 5.0E-125
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 16 609 1.0E-106
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 20 596 1.0E-82
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 30 536 3.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 319 341 22
2 370 392 22
3 402 424 22
4 451 473 22
5 488 505 17
6 518 540 22
7 550 572 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1994
MRPNLLLLAAAASPLATADRMLLSNSLNTCQEDSAFTASLFNLVYTPSNNSASIQMSIMSTIDGYVLFDAAISAY
GYTFFRKAVDPCEMKGFMGLCPMTPGVNTFRSNMAIDPEGAKQIPAIAFTIPDLDANVRMFVNKTSPDKQTTGSS
VSCLEASISNGKTVNLTGVKWATAIIAALALLSSAVFNGLGHFNAAAHVAANSLSLFSYFQAQAIIGLTSVPLPP
IVQAWTLNFQWSMGIIRSDVVLDICTWYQRATGGTPSRLFSTLRNVSVQVAKRSLDAVAKKLVKRGDITQDTGSY
IVYGIKRVAFQSRIESSNLFMTGLIFFYLLFVITVLTVAAAKGILELCRRKKWTSRFIEFRNGWRTIIKGILYRL
ALLTYPQMSILCLWEFTQADSAAEVIIAVIIFFGLTSVLFWGASRLILIARRSVTLHQNPAYILFADPKVLNKWG
FLYIQFRASAYYFIFPTLGYILVKSMLVALGQHGNRGIAQAVGIFVLETGALIAASVMRPWMDKSTNSFNIAICA
VNFLNAICLLVFTNVLGAPGLVVGIFSIIFFILNAAFSLVLLILLIVTTTLTFFRKDPDARYQIMGDDRASFVKS
TPQVNATMELDALAATARGEKLRGTQSKEEREIVLGHHLADKTEAANF*
Coding >Ophun1|1994
ATGAGGCCAAACTTGCTGCTGCTCGCCGCGGCCGCGTCGCCACTAGCCACGGCGGATCGAATGCTGTTGTCCAAC
TCGCTCAACACTTGCCAAGAGGACAGCGCTTTCACGGCATCACTCTTCAATCTTGTCTACACGCCGAGCAATAAT
TCGGCCTCGATCCAGATGTCTATCATGTCGACCATTGACGGATATGTTTTGTTCGACGCTGCGATTTCAGCCTAT
GGCTACACCTTCTTTCGCAAGGCTGTCGATCCGTGTGAAATGAAGGGCTTCATGGGTCTCTGTCCTATGACGCCC
GGTGTCAACACGTTCAGATCTAATATGGCCATCGACCCTGAGGGCGCGAAGCAGATTCCTGCTATCGCGTTTACG
ATTCCTGATCTAGATGCCAACGTCCGCATGTTCGTCAACAAGACCTCGCCAGACAAGCAGACGACAGGGTCCAGC
GTTTCTTGCCTCGAAGCCTCCATATCGAACGGGAAAACCGTCAATCTTACCGGCGTGAAATGGGCTACGGCGATT
ATTGCTGCCTTGGCCCTCTTGTCGTCCGCCGTGTTCAACGGGCTCGGTCACTTCAACGCAGCTGCTCACGTCGCC
GCCAACTCGCTCTCGCTCTTTAGCTATTTCCAGGCCCAGGCTATAATAGGTCTCACCAGCGTTCCCCTTCCCCCT
ATCGTGCAAGCCTGGACTCTTAATTTCCAGTGGTCGATGGGTATTATTCGATCCGACGTCGTGCTAGATATTTGC
ACCTGGTATCAACGAGCAACGGGCGGGACTCCATCGCGACTCTTTAGCACCTTGCGCAACGTTTCCGTTCAGGTC
GCTAAACGATCTCTCGATGCCGTCGCCAAGAAGCTGGTCAAGCGAGGCGACATCACACAAGACACCGGCTCCTAC
ATTGTCTACGGTATCAAGCGCGTGGCATTTCAATCTAGAATCGAATCCAGTAACCTCTTCATGACGGGCCTCATT
TTCTTCTACCTCCTCTTCGTCATAACCGTTCTAACCGTCGCCGCGGCCAAGGGGATCCTGGAACTTTGCCGCCGG
AAGAAATGGACGAGCAGATTCATCGAATTCCGCAACGGGTGGCGAACCATTATCAAGGGCATTCTCTACCGGCTG
GCTCTTCTGACCTACCCGCAGATGAGCATCCTCTGCCTCTGGGAATTCACACAGGCCGATTCTGCCGCCGAAGTC
ATCATCGCCGTCATCATATTCTTCGGTTTAACTAGCGTTCTCTTCTGGGGTGCCAGCAGACTCATCCTCATCGCC
CGTCGCTCGGTTACTCTACATCAGAACCCGGCGTACATCTTGTTCGCCGATCCCAAGGTTCTTAACAAATGGGGA
TTCCTTTACATCCAGTTCCGAGCTTCGGCGTATTATTTCATCTTTCCTACTCTCGGATATATCCTCGTCAAGTCG
ATGCTCGTGGCCCTTGGACAGCATGGCAATCGCGGTATTGCTCAGGCCGTTGGAATCTTCGTGCTCGAAACGGGC
GCCTTAATCGCTGCGTCAGTTATGCGTCCGTGGATGGATAAGAGCACTAATTCCTTCAACATTGCTATCTGCGCC
GTCAATTTCTTGAACGCAATTTGTCTACTAGTGTTTACAAACGTTCTAGGAGCGCCCGGTCTTGTCGTCGGAATC
TTTAGCATCATCTTCTTTATCCTCAACGCCGCCTTCTCACTTGTCCTTCTCATCCTACTCATCGTAACGACAACA
CTCACCTTCTTCCGGAAGGATCCGGATGCTCGTTATCAGATCATGGGTGACGATCGAGCGTCGTTTGTGAAGTCG
ACGCCGCAGGTGAATGCGACAATGGAGCTCGATGCTCTGGCTGCCACGGCTCGGGGTGAAAAGCTCCGGGGGACG
CAGTCTAAGGAAGAGAGAGAGATCGTTCTGGGTCATCATTTGGCCGATAAGACGGAGGCAGCGAACTTTTAG
Transcript >Ophun1|1994
ATGAGGCCAAACTTGCTGCTGCTCGCCGCGGCCGCGTCGCCACTAGCCACGGCGGATCGAATGCTGTTGTCCAAC
TCGCTCAACACTTGCCAAGAGGACAGCGCTTTCACGGCATCACTCTTCAATCTTGTCTACACGCCGAGCAATAAT
TCGGCCTCGATCCAGATGTCTATCATGTCGACCATTGACGGATATGTTTTGTTCGACGCTGCGATTTCAGCCTAT
GGCTACACCTTCTTTCGCAAGGCTGTCGATCCGTGTGAAATGAAGGGCTTCATGGGTCTCTGTCCTATGACGCCC
GGTGTCAACACGTTCAGATCTAATATGGCCATCGACCCTGAGGGCGCGAAGCAGATTCCTGCTATCGCGTTTACG
ATTCCTGATCTAGATGCCAACGTCCGCATGTTCGTCAACAAGACCTCGCCAGACAAGCAGACGACAGGGTCCAGC
GTTTCTTGCCTCGAAGCCTCCATATCGAACGGGAAAACCGTCAATCTTACCGGCGTGAAATGGGCTACGGCGATT
ATTGCTGCCTTGGCCCTCTTGTCGTCCGCCGTGTTCAACGGGCTCGGTCACTTCAACGCAGCTGCTCACGTCGCC
GCCAACTCGCTCTCGCTCTTTAGCTATTTCCAGGCCCAGGCTATAATAGGTCTCACCAGCGTTCCCCTTCCCCCT
ATCGTGCAAGCCTGGACTCTTAATTTCCAGTGGTCGATGGGTATTATTCGATCCGACGTCGTGCTAGATATTTGC
ACCTGGTATCAACGAGCAACGGGCGGGACTCCATCGCGACTCTTTAGCACCTTGCGCAACGTTTCCGTTCAGGTC
GCTAAACGATCTCTCGATGCCGTCGCCAAGAAGCTGGTCAAGCGAGGCGACATCACACAAGACACCGGCTCCTAC
ATTGTCTACGGTATCAAGCGCGTGGCATTTCAATCTAGAATCGAATCCAGTAACCTCTTCATGACGGGCCTCATT
TTCTTCTACCTCCTCTTCGTCATAACCGTTCTAACCGTCGCCGCGGCCAAGGGGATCCTGGAACTTTGCCGCCGG
AAGAAATGGACGAGCAGATTCATCGAATTCCGCAACGGGTGGCGAACCATTATCAAGGGCATTCTCTACCGGCTG
GCTCTTCTGACCTACCCGCAGATGAGCATCCTCTGCCTCTGGGAATTCACACAGGCCGATTCTGCCGCCGAAGTC
ATCATCGCCGTCATCATATTCTTCGGTTTAACTAGCGTTCTCTTCTGGGGTGCCAGCAGACTCATCCTCATCGCC
CGTCGCTCGGTTACTCTACATCAGAACCCGGCGTACATCTTGTTCGCCGATCCCAAGGTTCTTAACAAATGGGGA
TTCCTTTACATCCAGTTCCGAGCTTCGGCGTATTATTTCATCTTTCCTACTCTCGGATATATCCTCGTCAAGTCG
ATGCTCGTGGCCCTTGGACAGCATGGCAATCGCGGTATTGCTCAGGCCGTTGGAATCTTCGTGCTCGAAACGGGC
GCCTTAATCGCTGCGTCAGTTATGCGTCCGTGGATGGATAAGAGCACTAATTCCTTCAACATTGCTATCTGCGCC
GTCAATTTCTTGAACGCAATTTGTCTACTAGTGTTTACAAACGTTCTAGGAGCGCCCGGTCTTGTCGTCGGAATC
TTTAGCATCATCTTCTTTATCCTCAACGCCGCCTTCTCACTTGTCCTTCTCATCCTACTCATCGTAACGACAACA
CTCACCTTCTTCCGGAAGGATCCGGATGCTCGTTATCAGATCATGGGTGACGATCGAGCGTCGTTTGTGAAGTCG
ACGCCGCAGGTGAATGCGACAATGGAGCTCGATGCTCTGGCTGCCACGGCTCGGGGTGAAAAGCTCCGGGGGACG
CAGTCTAAGGAAGAGAGAGAGATCGTTCTGGGTCATCATTTGGCCGATAAGACGGAGGCAGCGAACTTTTAG
Gene >Ophun1|1994
ATGAGGCCAAACTTGCTGCTGCTCGCCGCGGCCGCGTCGCCACTAGCCACGGCGGATCGAATGCTGTTGTCCAAC
TCGCTCAACACTTGCCAAGAGGACAGCGCTTTCACGGCATCACTCTTCAATCTTGTCTACACGCCGAGCAATAAT
TCGGCCTCGATCCAGATGTCTATCATGTCGACCATTGACGGATATGTTTTGTTCGACGCTGCGATTTCAGCCTAT
GGCTACACCTTCTTTCGCAAGGCTGTCGATCCGTGTGAAATGAAGGGCTTCATGGGTCTCTGTCCTATGACGCCC
GGTGTCAACACGTTCAGATCTAATATGGCCATCGACCCTGAGGGCGCGAAGCAGATTCCTGCTATCGCGTTTACG
ATTCCTGATCTAGATGCCAACGTCCGCATGTTCGTCAACAAGACCTCGCCAGACAAGCAGACGACAGGGTCCAGC
GTTTCTTGCCTCGAAGCCTCCATATCGAACGGGAAAACCGTCAATCTTACCGGCGTGAAATGGGCTACGGCGATT
ATTGCTGCCTTGGCCCTCTTGTCGTCCGCCGTGTTCAACGGGCTCGGTCACTTCAACGCAGCTGCTCACGTCGCC
GCCAACTCGCTCTCGCTCTTTAGCTATTTCCAGGCCCAGGCTATAATAGGTCTCACCAGCGTTCCCCTTCCCCCT
ATCGTGCAAGCCTGGACTCTTAATTTCCAGTGGTCGATGGGTATTATTCGATCCGACGTCGTGCTAGATATTTGC
ACCTGGTATCAACGAGCAACGGGCGGGACTCCATCGCGACTCTTTAGCACCTTGCGCAACGTTTCCGTTCAGGTC
GCTAAACGATCTCTCGATGCCGTCGCCAAGAAGCTGGTCAAGCGAGGCGACATCACACAAGACACCGGCTCCTAC
ATTGTCTACGGTATCAAGCGCGTGGCATTTCAATCTAGAATCGAATCCAGTAACCTCTTCATGACGGGCCTCATT
TTCTTCTACCTCCTCTTCGTCATAACCGTTCTAACCGTCGCCGCGGCCAAGGGGATCCTGGAACTTTGCCGCCGG
AAGAAATGGACGAGCAGATTCATCGAATTCCGCAACGGGTGGCGAACCATTATCAAGGGCATTCTCTACCGGCTG
GCTCTTCTGACCTACCCGCAGATGAGCATCCTCTGCCTCTGGGAATTCACACAGGCCGATTCTGCCGCCGAAGTC
ATCATCGCCGTCATCATATTCTTCGGTTTAACTAGCGTTCTCTTCTGGGGTGCCAGCAGACTCATCCTCATCGCC
CGTCGCTCGGTTACTCTACATCAGAACCCGGCGTACATCTTGTTCGCCGATCCCAAGGTTCTTAACAAATGGGGA
TTCCTTTACATCCAGTTCCGAGCTTCGGCGTATTATTTCATCTTTCCTACTCTCGGATATATCCTCGTCAAGTCG
ATGCTCGTGGCCCTTGGACAGCATGGCAATCGCGGTATTGCTCAGGCCGTTGGAATCTTCGTGCTCGAAACGGGC
GCCTTAATCGCTGCGTCAGTTATGCGTCCGTGGATGGATAAGAGCACTAATTCCTTCAACATTGCTATCTGCGCC
GTCAATTTCTTGAACGCAATTTGTCTACTAGTGTTTACAAACGTTCTAGGAGCGCCCGGTCTTGTCGTCGGAATC
TTTAGCATCATCTTCTTTATCCTCAACGCCGCCTTCTCACTTGTCCTTCTCATCCTACTCATCGTAACGACAACA
CTCACCTTCTTCCGGAAGGATCCGGATGCTCGTTATCAGATCATGGGTGACGATCGAGCGTCGTTTGTGAAGTCG
ACGCCGCAGGTGAATGCGACAATGGAGCTCGATGCTCTGGCTGCCACGGCTCGGGGTGAAAAGCTCCGGGGGACG
CAGTCTAAGGAAGAGAGAGAGAGTCTGTTTCGGGATGGACGCCGGCAGATGGCTTATCGTGAGGCGTCGCCGAGT
GCGATGTATAGTCGTTCTGGGTCATCATTTGGCCGATAAGACGGAGGCAGCGAACTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail