Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1992
Gene name
LocationContig_191:274..1754
Strand+
Gene length (bp)1480
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 5.3E-26 127 414
PF11960 DUF3474 Domain of unknown function (DUF3474) 8.2E-08 65 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8H5|FAD12_MORAP Delta(12) fatty acid desaturase OS=Mortierella alpina PE=1 SV=2 68 455 4.0E-103
sp|P59668|FAD12_MORIS Delta(12) fatty acid desaturase OS=Mortierella isabellina PE=2 SV=1 68 455 1.0E-102
sp|Q84VT2|FAD12_PUNGR Delta(12)-acyl-lipid-desaturase OS=Punica granatum GN=FAD12 PE=2 SV=2 68 456 1.0E-93
sp|A3F5L3|DES2_SORBI Fatty acid desaturase DES2 OS=Sorghum bicolor GN=DES2 PE=2 SV=1 68 445 4.0E-93
sp|Q84UB9|FAD12_TRIKI Delta(12)-oleate desaturase OS=Trichosanthes kirilowii GN=FAD2 PE=2 SV=1 68 456 2.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8H5|FAD12_MORAP Delta(12) fatty acid desaturase OS=Mortierella alpina PE=1 SV=2 68 455 4.0E-103
sp|P59668|FAD12_MORIS Delta(12) fatty acid desaturase OS=Mortierella isabellina PE=2 SV=1 68 455 1.0E-102
sp|Q84VT2|FAD12_PUNGR Delta(12)-acyl-lipid-desaturase OS=Punica granatum GN=FAD12 PE=2 SV=2 68 456 1.0E-93
sp|A3F5L3|DES2_SORBI Fatty acid desaturase DES2 OS=Sorghum bicolor GN=DES2 PE=2 SV=1 68 445 4.0E-93
sp|Q84UB9|FAD12_TRIKI Delta(12)-oleate desaturase OS=Trichosanthes kirilowii GN=FAD2 PE=2 SV=1 68 456 2.0E-90
sp|P48631|FD6E2_SOYBN Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 OS=Glycine max GN=FAD2-2 PE=2 SV=1 65 456 7.0E-90
sp|P48630|FD6E1_SOYBN Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 OS=Glycine max GN=FAD2-1 PE=2 SV=1 66 456 1.0E-89
sp|P46313|FAD6E_ARATH Delta(12)-fatty-acid desaturase OS=Arabidopsis thaliana GN=FAD2 PE=1 SV=1 68 456 1.0E-88
sp|Q39287|FAD6E_BRAJU Omega-6 fatty acid desaturase, endoplasmic reticulum OS=Brassica juncea PE=2 SV=1 66 456 3.0E-88
sp|Q41131|FH12_RICCO Phosphatidylcholine 12-monooxygenase OS=Ricinus communis GN=FAH12 PE=1 SV=1 42 456 2.0E-86
sp|D2CPE1|FH12M_RICCO Phosphatidylcholine 12-monooxygenase OS=Ricinus communis GN=FAH12 PE=2 SV=1 42 456 4.0E-85
sp|Q8GZC3|FAD2_VERFO Delta(12)-fatty-acid desaturase FAD2 OS=Vernicia fordii GN=FAD2 PE=1 SV=1 68 456 5.0E-85
sp|Q84UB8|FADX_PUNGR Bifunctional fatty acid conjugase/Delta(12)-oleate desaturase OS=Punica granatum GN=FADX PE=1 SV=1 68 456 1.0E-83
sp|Q84UC0|FADX_TRIKI Bifunctional fatty acid conjugase/Delta(12)-oleate desaturase OS=Trichosanthes kirilowii GN=FAC PE=2 SV=1 68 456 3.0E-81
sp|Q9SP62|FADX_IMPBA Delta(12) acyl-lipid conjugase (11E,13E-forming) OS=Impatiens balsamina GN=FADX PE=1 SV=1 67 456 7.0E-81
sp|Q6RS95|FAD21_DIMSI Acyl-lipid (9+3)-(E)-desaturase OS=Dimorphotheca sinuata PE=1 SV=1 65 456 5.0E-78
sp|Q8GZC2|FADX_VERFO Bifunctional desaturase/conjugase FADX OS=Vernicia fordii PE=1 SV=1 66 456 3.0E-77
sp|Q9SP61|FADX_MOMCH Delta(12) acyl-lipid conjugase (11E,13E-forming) OS=Momordica charantia GN=FADX PE=1 SV=1 68 456 7.0E-77
sp|O81931|FAD12_CREAL Delta(12) fatty acid dehydrogenase OS=Crepis alpina PE=1 SV=2 68 455 3.0E-75
sp|Q6RS96|FAD22_DIMSI Delta(9) fatty acid conjugase-like enzyme OS=Dimorphotheca sinuata PE=2 SV=1 66 457 6.0E-69
sp|P48626|FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1 67 442 1.0E-59
sp|P48619|FAD3C_RICCO Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1 61 421 4.0E-53
sp|P32291|FAD3E_VIGRR Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Vigna radiata var. radiata GN=ARG1 PE=2 SV=1 59 423 4.0E-52
sp|P48622|FAD3D_ARATH Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD8 PE=2 SV=1 67 421 3.0E-50
sp|P48620|FAD3C_SESIN Omega-3 fatty acid desaturase, chloroplastic OS=Sesamum indicum GN=FAD7 PE=2 SV=1 67 423 4.0E-50
sp|P46310|FAD3C_ARATH Omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD7 PE=2 SV=1 67 421 1.0E-49
sp|P48618|FAD3C_BRANA Omega-3 fatty acid desaturase, chloroplastic (Fragment) OS=Brassica napus GN=FAD7 PE=2 SV=1 67 421 6.0E-49
sp|P48623|FAD3E_ARATH Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1 68 459 3.0E-47
sp|P48625|FAD3E_SOYBN Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1 67 443 3.0E-47
sp|P48624|FAD3E_BRANA Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Brassica napus GN=FAD3 PE=2 SV=1 68 459 7.0E-46
sp|A3F5L2|DES1_SORBI Probable fatty acid desaturase DES1 OS=Sorghum bicolor GN=DES1 PE=2 SV=1 43 421 1.0E-43
sp|Q594P3|DES3_SORBI Fatty acid desaturase DES3 OS=Sorghum bicolor GN=DES3 PE=1 SV=1 43 420 1.0E-43
sp|P48621|FAD3C_SOYBN Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1 67 423 2.0E-41
sp|G5EGA5|FAT2_CAEEL Delta(12) fatty acid desaturase fat-2 OS=Caenorhabditis elegans GN=fat-2 PE=2 SV=1 71 408 1.0E-36
sp|Q9NEQ0|FAT1_CAEEL Omega-3 fatty acid desaturase fat-1 OS=Caenorhabditis elegans GN=fat-1 PE=2 SV=1 71 456 3.0E-35
sp|Q54794|DESA_ARTPT Delta(12)-fatty-acid desaturase OS=Arthrospira platensis GN=desA PE=1 SV=1 140 417 4.0E-18
sp|P46312|FAD6C_ARATH Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD6 PE=1 SV=2 47 411 2.0E-17
sp|P48627|FAD6C_BRANA Omega-6 fatty acid desaturase, chloroplastic OS=Brassica napus PE=2 SV=1 47 411 1.0E-16
sp|P48629|FAD6C_SPIOL Omega-6 fatty acid desaturase, chloroplastic OS=Spinacia oleracea GN=FAD6 PE=1 SV=1 43 411 1.0E-15
sp|P48628|FAD6C_SOYBN Omega-6 fatty acid desaturase, chloroplastic OS=Glycine max PE=2 SV=1 69 411 5.0E-15
sp|P20388|DESA_SYNY3 Delta(12)-fatty-acid desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=desA PE=1 SV=1 69 409 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Yes
GO:0006629 lipid metabolic process Yes
GO:0003674 molecular_function No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1992
MASPVSPSGPVLQRILSDSESSAAVSPLDSPRPSLSPSSTSLSSLASADGDSKYAGLLDTYGNAFTPPDFTIKDI
RDAIPKHCFERSALTGYSYILRDMACLATTFVVFHNLVTPELIPSTPVRTALWAVYTFLQGMFGTGLWVIAHECG
HGAFSPSRLINDATGWVLHSALLVPYFSWQISHSKHHKATGNMERDMVFVPRTRDQQASRVGALVREMGELAEDT
PIATLAHIIGQQLMGWPYYLITNVTGHNYHERQREGRGKGKSNGLGGGVNHFDPRSPLYESKDAKLIVLSDIGIG
LAAAALYMLGNRFGWYNMAIWYFVPYLWVNSWLVGITFLQHTDPSLPHYTSEEWNFVRGAAATIDREMGFIGRHL
LHGIIETHVLHHYVSTIPFYNADEATDAIRPVMGKHYRSDTEGGPLGFVRALWRSSRMCKWVEPSAEAQGSAKGI
LFFRNNNGLGTRPIGAKTE*
Coding >Ophun1|1992
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCGTCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCAGGGCTCCTCGACACGTACGGGAACGCGTTTACGCCTCCCGACTTCACCATCAAGGACATC
CGCGATGCCATCCCCAAGCACTGCTTCGAACGCTCCGCCTTGACCGGCTACTCGTACATCCTCCGCGACATGGCC
TGCCTCGCCACCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACACCCGTCCGCACC
GCCCTTTGGGCCGTCTACACTTTTCTGCAGGGCATGTTTGGCACCGGTCTCTGGGTCATTGCCCACGAGTGCGGA
CACGGTGCCTTCTCCCCCTCGCGTCTCATCAACGACGCCACGGGATGGGTGCTGCACTCGGCCCTGCTCGTTCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTTTTCGTG
CCTCGCACCCGGGACCAGCAGGCCTCGCGTGTCGGAGCTCTTGTCCGCGAGATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCCCATATCATCGGACAGCAGCTTATGGGCTGGCCTTACTACCTCATCACCAACGTCACT
GGCCACAACTACCACGAGCGTCAACGCGAGGGCCGTGGCAAGGGCAAGAGCAACGGGCTCGGCGGCGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTGTACGAGAGCAAGGACGCCAAGCTCATCGTCCTCAGCGACATTGGCATCGGC
CTGGCCGCTGCCGCGCTCTATATGCTCGGAAACCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTGAATTCGTGGCTGGTGGGCATCACGTTCCTTCAGCATACGGATCCGTCTCTGCCTCACTACACC
TCTGAGGAGTGGAACTTTGTGCGCGGTGCGGCTGCCACCATTGATCGTGAGATGGGCTTCATCGGCCGCCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCACCATCCCCTTTTACAACGCAGACGAGGCC
ACCGATGCCATCCGCCCTGTCATGGGCAAGCATTACCGCTCCGACACGGAGGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGCTCCAGGATGTGCAAATGGGTTGAGCCGAGCGCCGAGGCTCAGGGATCGGCGAAAGGCATC
CTCTTCTTCCGCAACAACAACGGTCTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Transcript >Ophun1|1992
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCGTCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCAGGGCTCCTCGACACGTACGGGAACGCGTTTACGCCTCCCGACTTCACCATCAAGGACATC
CGCGATGCCATCCCCAAGCACTGCTTCGAACGCTCCGCCTTGACCGGCTACTCGTACATCCTCCGCGACATGGCC
TGCCTCGCCACCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACACCCGTCCGCACC
GCCCTTTGGGCCGTCTACACTTTTCTGCAGGGCATGTTTGGCACCGGTCTCTGGGTCATTGCCCACGAGTGCGGA
CACGGTGCCTTCTCCCCCTCGCGTCTCATCAACGACGCCACGGGATGGGTGCTGCACTCGGCCCTGCTCGTTCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTTTTCGTG
CCTCGCACCCGGGACCAGCAGGCCTCGCGTGTCGGAGCTCTTGTCCGCGAGATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCCCATATCATCGGACAGCAGCTTATGGGCTGGCCTTACTACCTCATCACCAACGTCACT
GGCCACAACTACCACGAGCGTCAACGCGAGGGCCGTGGCAAGGGCAAGAGCAACGGGCTCGGCGGCGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTGTACGAGAGCAAGGACGCCAAGCTCATCGTCCTCAGCGACATTGGCATCGGC
CTGGCCGCTGCCGCGCTCTATATGCTCGGAAACCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTGAATTCGTGGCTGGTGGGCATCACGTTCCTTCAGCATACGGATCCGTCTCTGCCTCACTACACC
TCTGAGGAGTGGAACTTTGTGCGCGGTGCGGCTGCCACCATTGATCGTGAGATGGGCTTCATCGGCCGCCACCTG
CTGCACGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCACCATCCCCTTTTACAACGCAGACGAGGCC
ACCGATGCCATCCGCCCTGTCATGGGCAAGCATTACCGCTCCGACACGGAGGGTGGCCCGCTGGGCTTCGTCCGC
GCCTTGTGGAGGAGCTCCAGGATGTGCAAATGGGTTGAGCCGAGCGCCGAGGCTCAGGGATCGGCGAAAGGCATC
CTCTTCTTCCGCAACAACAACGGTCTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA
Gene >Ophun1|1992
ATGGCCTCTCCCGTCTCTCCCAGCGGCCCGGTGCTGCAGCGGATCTTGTCCGACTCGGAGTCGTCGGCTGCCGTC
TCGCCGTTAGACTCGCCTCGGCCGTCGCTCTCGCCTTCGTCGACGTCCCTCTCGTCGCTCGCCTCGGCTGACGGC
GACTCCAAGTACGCAGGGCTCCTCGACACGTACGGGAACGCGTTTACGCCTCCCGACTTCACCATCAAGGACATC
CGCGATGCCATCCCCAAGCACTGCTTCGAACGCTCCGCCTTGACCGGCTACTCGTACATCCTCCGCGACATGGCC
TGCCTCGCCACCACCTTTGTCGTCTTCCACAACCTCGTCACGCCCGAGTTGATCCCCTCAACACCCGTCCGCACC
GCCCTTTGGGCCGTCTACACTTTTCTGCAGGGCATGTTTGGCACCGGTCTCTGGGTCATTGCCCACGAGTGCGGA
CACGGTGCCTTCTCCCCCTCGCGTCTCATCAACGACGCCACGGGATGGGTGCTGCACTCGGCCCTGCTCGTTCCC
TACTTCAGCTGGCAAATCTCCCACAGCAAGCACCACAAGGCCACGGGCAACATGGAACGCGACATGGTTTTCGTG
CCTCGCACCCGGGACCAGCAGGCCTCGCGTGTCGGAGCTCTTGTCCGCGAGATGGGCGAGCTGGCCGAGGACACG
CCCATTGCCACCCTTGCCCATATCATCGGACAGCAGCTTATGGGCTGGCCTTACTACCTCATCACCAACGTCACT
GGCCACAACTACCACGAGCGTCAACGCGAGGGCCGTGGCAAGGGCAAGAGCAACGGGCTCGGCGGCGGTGTCAAT
CACTTTGACCCTCGCAGCCCGCTGTACGAGAGCAAGGACGCCAAGCTCATCGTCCTCAGCGACATTGGCATCGGC
CTGGCCGCTGCCGCGCTCTATATGCTCGGAAACCGCTTCGGCTGGTACAACATGGCCATCTGGTACTTTGTGCCG
TATCTCTGGGTGAATTCGTGGCTGGGTACGACTCACTTCTTTCTCTCCCTTACTCAACCTCGTTGTCTTCATTGC
TAACCGAGTTCTTCTGTCAGTGGGCATCACGTTCCTTCAGCATACGGATCCGTCTCTGCCTCACTACACCTCTGA
GGAGTGGAACTTTGTGCGCGGTGCGGCTGCCACCATTGATCGTGAGATGGGCTTCATCGGCCGCCACCTGCTGCA
CGGCATCATCGAGACGCATGTGCTGCACCATTATGTCAGCACCATCCCCTTTTACAACGCAGACGAGGCCACCGA
TGCCATCCGCCCTGTCATGGGCAAGCATTACCGCTCCGACACGGAGGGTGGCCCGCTGGGCTTCGTCCGCGCCTT
GTGGAGGAGCTCCAGGATGTGCAAATGGGTTGAGCCGAGCGCCGAGGCTCAGGGATCGGCGAAAGGCATCCTCTT
CTTCCGCAACAACAACGGTCTGGGCACGAGGCCCATCGGTGCCAAGACGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail