Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1979
Gene name
LocationContig_19:65950..67151
Strand+
Gene length (bp)1201
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 4.1E-34 102 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 217 327 1.0E-11
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 217 327 7.0E-11
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 219 327 8.0E-11
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 217 327 1.0E-10
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 219 327 2.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|122
Ophiocordyceps australis map64 (Brazil) OphauB2|2755
Ophiocordyceps camponoti-floridani Ophcf2|04015
Ophiocordyceps camponoti-rufipedis Ophun1|1979 (this protein)
Ophiocordyceps kimflemingae Ophio5|8573
Ophiocordyceps subramaniannii Hirsu2|7831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1979
MMEGGKRKADDEGETTEVKIAMLASMHPDVGPEKLLDMLVAHQGSIASTTAALRRPKPSAKQQSSLRRYAPITSS
SGRKIKAVKGRTLHVFDPVDVAEHTPCTVVHDFLPAGVAEGLLRELLAEAETFERSSFKLFENVVESPHSAAFFV
EGGEERVLREEYFYNGSRLTDVRTITPFLAKVKPRVQEAVNREIQHRIATHYPNGRKLRHQPPGPWTANSAFVNC
YGGGNESVGWHSDQLTYLGPRAVIGSLSLGVTREFRVRRVAVGGDDVGDEASQGVISIHLPHNSLLVMHAEMQEE
WKHCVAPAAAIDAHPVSGNRRINVTYRDYRAVGMLHVLLG*
Coding >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGACGTGCGAACGATA
ACGCCTTTCCTGGCAAAGGTCAAGCCACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACG
CACTACCCCAACGGCCGCAAGCTCCGACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGC
TACGGCGGCGGGAACGAGAGCGTCGGCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGA
TCCCTCTCTTTAGGGGTGACGCGCGAGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAG
GCTTCGCAGGGGGTGATTTCGATTCACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAG
TGGAAGCATTGCGTTGCGCCGGCTGCGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACG
TATCGGGATTATCGGGCGGTCGGGATGCTCCATGTTTTGCTGGGCTGA
Transcript >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGACGTGCGAACGATA
ACGCCTTTCCTGGCAAAGGTCAAGCCACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACG
CACTACCCCAACGGCCGCAAGCTCCGACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGC
TACGGCGGCGGGAACGAGAGCGTCGGCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGA
TCCCTCTCTTTAGGGGTGACGCGCGAGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAG
GCTTCGCAGGGGGTGATTTCGATTCACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAG
TGGAAGCATTGCGTTGCGCCGGCTGCGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACG
TATCGGGATTATCGGGCGGTCGGGATGCTCCATGTTTTGCTGGGCTGA
Gene >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGTATGTCTGTTTTCT
ACGAGGTCGTGGGATGGAACTGACGAGCGAGATAGGACGTGCGAACGATAACGCCTTTCCTGGCAAAGGTCAAGC
CACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACGCACTACCCCAACGGCCGCAAGCTCC
GACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGCTACGGCGGCGGGAACGAGAGCGTCG
GCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGATCCCTCTCTTTAGGGGTGACGCGCG
AGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAGGCTTCGCAGGGGGTGATTTCGATTC
ACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAGTGGAAGCATTGCGTTGCGCCGGCTG
CGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACGTATCGGGATTATCGGGCGGTGATGC
ATCCGCGGAGGACGCCGCGTTGCGGGTGTGGGGTTCCGTGTGTGTTGAGGGTTGTGCAGAGGAAGAGGGAGACGG
TTGGGAGGTATTTCTGGATGTGTCATGCTGGGAATGTGCCTGGGAGGTCGGGATGCTCCATGTTTTGCTGGGCTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail