Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1979
Gene name
LocationContig_19:65950..67151
Strand+
Gene length (bp)1201
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 4.1E-34 102 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 217 327 1.0E-11
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 217 327 7.0E-11
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 219 327 8.0E-11
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 217 327 1.0E-10
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 219 327 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1979
MMEGGKRKADDEGETTEVKIAMLASMHPDVGPEKLLDMLVAHQGSIASTTAALRRPKPSAKQQSSLRRYAPITSS
SGRKIKAVKGRTLHVFDPVDVAEHTPCTVVHDFLPAGVAEGLLRELLAEAETFERSSFKLFENVVESPHSAAFFV
EGGEERVLREEYFYNGSRLTDVRTITPFLAKVKPRVQEAVNREIQHRIATHYPNGRKLRHQPPGPWTANSAFVNC
YGGGNESVGWHSDQLTYLGPRAVIGSLSLGVTREFRVRRVAVGGDDVGDEASQGVISIHLPHNSLLVMHAEMQEE
WKHCVAPAAAIDAHPVSGNRRINVTYRDYRAVGMLHVLLG*
Coding >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGACGTGCGAACGATA
ACGCCTTTCCTGGCAAAGGTCAAGCCACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACG
CACTACCCCAACGGCCGCAAGCTCCGACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGC
TACGGCGGCGGGAACGAGAGCGTCGGCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGA
TCCCTCTCTTTAGGGGTGACGCGCGAGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAG
GCTTCGCAGGGGGTGATTTCGATTCACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAG
TGGAAGCATTGCGTTGCGCCGGCTGCGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACG
TATCGGGATTATCGGGCGGTCGGGATGCTCCATGTTTTGCTGGGCTGA
Transcript >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGACGTGCGAACGATA
ACGCCTTTCCTGGCAAAGGTCAAGCCACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACG
CACTACCCCAACGGCCGCAAGCTCCGACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGC
TACGGCGGCGGGAACGAGAGCGTCGGCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGA
TCCCTCTCTTTAGGGGTGACGCGCGAGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAG
GCTTCGCAGGGGGTGATTTCGATTCACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAG
TGGAAGCATTGCGTTGCGCCGGCTGCGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACG
TATCGGGATTATCGGGCGGTCGGGATGCTCCATGTTTTGCTGGGCTGA
Gene >Ophun1|1979
ATGATGGAGGGTGGGAAGAGAAAGGCCGATGATGAGGGAGAGACGACGGAGGTGAAGATTGCGATGCTTGCTTCG
ATGCATCCGGATGTTGGGCCGGAGAAACTGCTGGATATGCTCGTGGCGCATCAGGGATCCATCGCCAGCACGACA
GCAGCCCTTCGACGACCGAAGCCGAGCGCAAAGCAGCAATCCTCGCTCCGACGGTACGCGCCCATCACGTCCAGC
AGCGGCAGGAAGATCAAGGCGGTCAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTGGCAGAGCATACG
CCTTGCACGGTGGTGCATGATTTCTTGCCGGCGGGAGTGGCGGAGGGGTTGCTGAGGGAGTTGCTGGCCGAGGCG
GAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGAGAATGTTGTCGAGAGTCCGCACTCGGCTGCTTTTTTTGTG
GAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTACAACGGATCGAGGTTGACGGTATGTCTGTTTTCT
ACGAGGTCGTGGGATGGAACTGACGAGCGAGATAGGACGTGCGAACGATAACGCCTTTCCTGGCAAAGGTCAAGC
CACGCGTTCAAGAAGCCGTCAACCGGGAAATCCAGCACCGCATCGCAACGCACTACCCCAACGGCCGCAAGCTCC
GACACCAACCTCCCGGACCATGGACGGCCAACTCGGCCTTTGTCAACTGCTACGGCGGCGGGAACGAGAGCGTCG
GCTGGCATAGCGACCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGATCCCTCTCTTTAGGGGTGACGCGCG
AGTTCCGGGTGCGGAGGGTGGCGGTGGGTGGTGATGATGTGGGGGACGAGGCTTCGCAGGGGGTGATTTCGATTC
ACCTTCCGCATAACTCGCTGCTGGTGATGCACGCGGAGATGCAGGAGGAGTGGAAGCATTGCGTTGCGCCGGCTG
CGGCCATTGATGCGCATCCCGTGTCGGGGAATCGGCGGATCAACGTCACGTATCGGGATTATCGGGCGGTGATGC
ATCCGCGGAGGACGCCGCGTTGCGGGTGTGGGGTTCCGTGTGTGTTGAGGGTTGTGCAGAGGAAGAGGGAGACGG
TTGGGAGGTATTTCTGGATGTGTCATGCTGGGAATGTGCCTGGGAGGTCGGGATGCTCCATGTTTTGCTGGGCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail