Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1975
Gene name
LocationContig_19:53208..56980
Strand-
Gene length (bp)3772
Transcript length (bp)3543
Coding sequence length (bp)3543
Protein length (aa) 1181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2.0E-69 4 1166
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 8.3E-20 522 641

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 1 1173 0.0E+00
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 1 1174 0.0E+00
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 1 1171 0.0E+00
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 1 1175 0.0E+00
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 1 1175 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 1 1173 0.0E+00
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 1 1174 0.0E+00
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 1 1171 0.0E+00
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 1 1175 0.0E+00
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 1 1175 0.0E+00
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 1 1172 0.0E+00
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 1 1172 0.0E+00
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 1 1172 0.0E+00
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 1 1171 0.0E+00
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 1 1171 4.0E-173
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 1 1179 1.0E-146
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 1 1175 2.0E-65
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 8 1174 3.0E-62
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 1 1175 1.0E-60
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 1 1169 1.0E-59
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 1 1175 1.0E-57
sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 1 1175 3.0E-56
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 10 1171 3.0E-53
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 1 1176 2.0E-52
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 8 1174 2.0E-51
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 1 1171 7.0E-49
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 11 1171 9.0E-47
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 510 1159 3.0E-39
sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 1 1176 4.0E-39
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 1 1179 2.0E-38
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 520 1175 9.0E-38
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 525 1171 1.0E-34
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 10 1147 2.0E-33
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 2 1156 4.0E-32
sp|Q7NG51|SMC_GLOVI Chromosome partition protein Smc OS=Gloeobacter violaceus (strain PCC 7421) GN=smc PE=3 SV=1 512 1158 4.0E-31
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 523 1157 4.0E-27
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 1 297 9.0E-27
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 521 1180 3.0E-26
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacter versatilis (strain Ellin345) GN=smc PE=3 SV=1 101 1147 1.0E-25
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 1 827 1.0E-25
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 3 736 2.0E-23
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 1 278 4.0E-22
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 1 721 1.0E-21
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 1 266 1.0E-21
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 1 205 2.0E-21
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 1 205 2.0E-21
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 1 211 4.0E-21
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 953 1160 1.0E-20
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 1 226 1.0E-20
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 1 263 2.0E-20
sp|Q9CBT5|SMC_MYCLE Chromosome partition protein Smc OS=Mycobacterium leprae (strain TN) GN=smc PE=3 SV=1 1 270 2.0E-20
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 1 178 1.0E-19
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 8 252 1.0E-19
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 1 210 2.0E-19
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 1 348 3.0E-19
sp|P73340|SMC_SYNY3 Chromosome partition protein Smc OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=smc PE=3 SV=1 966 1158 3.0E-18
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 620 1147 4.0E-18
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 1 914 4.0E-18
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 1032 1176 1.0E-17
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 970 1158 2.0E-17
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 1059 1177 3.0E-17
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 1 229 5.0E-17
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 1 174 9.0E-17
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 1059 1159 1.0E-16
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 661 1174 3.0E-16
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 1028 1174 4.0E-16
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 1059 1162 5.0E-16
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 1079 1162 2.0E-15
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 985 1175 3.0E-15
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 985 1175 3.0E-15
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 985 1175 3.0E-15
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 577 1147 4.0E-15
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 1059 1176 6.0E-15
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 1059 1179 7.0E-15
sp|Q8I1U7|SMC3_PLAF7 Structural maintenance of chromosomes protein 3 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0685c PE=3 SV=1 1 287 1.0E-14
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 985 1175 2.0E-14
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 1 276 9.0E-14
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 1079 1160 1.0E-13
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 10 384 2.0E-13
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 1017 1160 2.0E-13
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 985 1147 4.0E-13
sp|Q9CBT5|SMC_MYCLE Chromosome partition protein Smc OS=Mycobacterium leprae (strain TN) GN=smc PE=3 SV=1 984 1160 9.0E-13
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 1 280 1.0E-12
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 994 1180 2.0E-12
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 10 246 2.0E-12
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 985 1158 3.0E-12
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 985 1160 4.0E-12
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 971 1147 6.0E-12
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 990 1166 7.0E-12
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 984 1160 2.0E-11
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 6 174 3.0E-11
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 984 1160 4.0E-11
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 984 1160 4.0E-11
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 956 1147 4.0E-11
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 753 1159 4.0E-11
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1085 1153 7.0E-11
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 1032 1179 9.0E-11
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 1032 1179 9.0E-11
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 1032 1179 9.0E-11
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 1032 1179 1.0E-10
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 1032 1179 1.0E-10
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 1031 1179 2.0E-10
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 6 171 2.0E-10
sp|Q8KBS6|SMC_CHLTE Chromosome partition protein Smc OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=smc PE=3 SV=1 608 1147 3.0E-10
sp|P15016|YAT3_RHORU Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment) OS=Rhodospirillum rubrum PE=4 SV=1 1024 1179 3.0E-10
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 1017 1151 5.0E-10
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 1007 1151 1.0E-09
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 1034 1157 1.0E-09
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 549 879 7.0E-09
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 549 879 7.0E-09
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 549 879 7.0E-09
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 549 879 8.0E-09
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 1016 1166 2.0E-08
sp|Q8I1U7|SMC3_PLAF7 Structural maintenance of chromosomes protein 3 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0685c PE=3 SV=1 1015 1171 2.0E-08
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 549 879 4.0E-08
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 1069 1160 4.0E-08
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 256 701 3.0E-07
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 3 350 1.0E-06
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 3 504 2.0E-06
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 3 163 5.0E-06
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 3 168 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0051276 chromosome organization Yes
GO:0005694 chromosome Yes
GO:0005515 protein binding Yes
GO:0071840 cellular component organization or biogenesis No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3928
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5674
Ophiocordyceps australis map64 (Brazil) OphauB2|2750
Ophiocordyceps camponoti-floridani Ophcf2|04019
Ophiocordyceps camponoti-rufipedis Ophun1|1975 (this protein)
Ophiocordyceps kimflemingae Ophio5|8568
Ophiocordyceps subramaniannii Hirsu2|7826

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1975
MRVVEVIIDGFKSYAVRTIISGWDESFNSITGLNGSGKSNILDAICFVLGITNMSTVRAQNLQDLIYKRGQAGVT
KASVTIVFENRDKKKSPIGFEQYVAISVTRQIVLGGTSKYLINGHRAQQQTVQNLFQSVQLNINNPNFLIMQGRI
TKVLNMKAVEILAMIEEAAGTRMFEDRRDKALKTMAKKELKLQELRELLKDEIEPKLEKLRTEKRAFLDFQQTQN
DLERLTRLVVAYDYVRCQEKLKQSAADLEGKKQRQKDLESAVTRLRSEISHLEEDIGRVRAERDKELRKGGKAQA
LEEAVKKQANELVRLATVMDLKNTSLAEETEKKKAVEKTVSEMEAALKVKTAAFETAQSTYTAAKDELQKQSHEV
ESKEELLQTLQTGVASKNGQDNGYQGQLQDARNRATAAATEQEQAKIKINHLQSRLKEEEPRAKKAKEQNAGLLR
DLDGMRSQARKLESELGKLGLQPGRGEDLYKQESDLKETVRGLREEADKVKRQVANLDFSYTDPVAGFDRSKVKG
LVAQLFTLGEQHTRAGTALEICAGGRLYNVVVDSEVTGTQLLQRGKLRKRVTIIPLNKIAAFKASAQTLAMAQRM
APGKVDLALSLVGYDDEVSAAMEYVFGNTLVCADAETAKRVTFDPNIRMRSITLEGDAYDPSGTLSGGSAPSSSG
VLVTLQKLNSLTRRLEEAEKSLCEVQASIARDKSKLDQARRIEQDLDLKTHEIKLAEDQISNNSSSSIIQEVDKI
KTTMAELRTSIEEAKARQSGANAQAKQIEKDINEFDTNKDAKLIQLQKSLDKLRASLDKDSATVKALQKELQGAQ
LDVEQVGTDLSAARDQLQEADMAIRAQQRDVEGLAQQRSQVSETHDAAQAQLDDERAKLHLFDDELRALDEAVRS
KNARIAEDGLEMQKLGHQLERFHKERQAAADNVSRLESEHEWIADEKDKLGRPGTAYDFQGQNIGECKATLRNLT
DRFQGMRKKINPKVMNMIDSVEKKEVSLKHMVKTVIRDKRKIEETIVSLDEYKKKALHKTWEKVNGDFGNIFSEL
LPGGSFAKLDPPEGKTISDGLEVKVCLGKVWKQSLTELSGGQRSLVALSLIMALLQFKPAPMYILDEVDAALDLS
HTQNIGRLIRTRFKGSQFIVVSLKDGMFQNANRIFRTRFSEGTSMVQALTPADLK*
Coding >Ophun1|1975
ATGAGGGTGGTGGAAGTCATCATCGACGGCTTCAAGTCGTACGCCGTACGCACCATCATATCGGGATGGGACGAA
AGCTTCAACTCCATCACCGGCCTCAACGGCAGCGGGAAATCCAACATCCTCGACGCGATATGCTTCGTTCTCGGT
ATCACCAACATGTCTACAGTCCGAGCGCAAAACCTGCAGGACCTGATCTATAAACGCGGTCAAGCCGGTGTGACC
AAAGCCAGCGTGACAATCGTCTTCGAGAACCGCGACAAGAAGAAATCCCCCATCGGATTCGAGCAATACGTCGCC
ATCAGCGTCACCCGCCAGATTGTCCTCGGCGGAACCTCAAAATACCTCATCAACGGCCACCGAGCCCAGCAGCAA
ACAGTCCAAAACCTCTTCCAGTCGGTACAACTCAACATCAACAACCCCAACTTCCTCATCATGCAGGGCCGCATC
ACAAAAGTCCTCAACATGAAGGCCGTCGAGATACTAGCCATGATCGAAGAAGCAGCAGGCACGCGAATGTTTGAA
GATCGGAGAGACAAGGCGCTCAAGACGATGGCAAAGAAGGAGCTCAAGCTGCAGGAACTCCGCGAGCTCCTCAAG
GACGAAATCGAGCCCAAGCTGGAAAAGCTCCGTACCGAGAAGCGAGCCTTTCTCGACTTCCAACAGACGCAAAAC
GACCTCGAACGGCTCACGAGACTAGTTGTCGCTTACGACTACGTCCGCTGCCAGGAGAAACTCAAGCAATCGGCA
GCAGACCTCGAAGGCAAGAAGCAGCGTCAGAAAGATCTCGAGAGTGCAGTAACTCGCCTCCGCAGCGAAATATCC
CACCTGGAAGAGGACATTGGCCGGGTGCGTGCCGAGCGCGACAAGGAGCTCCGAAAGGGCGGCAAAGCCCAAGCA
CTAGAAGAGGCCGTCAAGAAGCAGGCCAACGAGCTCGTGCGCCTCGCCACCGTCATGGACCTGAAGAACACGAGT
CTGGCGGAGGAAACGGAGAAGAAGAAGGCGGTGGAGAAGACGGTATCCGAGATGGAAGCCGCCCTCAAAGTCAAG
ACAGCCGCCTTCGAAACTGCCCAGTCGACATACACGGCAGCAAAAGACGAGCTCCAGAAGCAAAGCCACGAGGTC
GAATCCAAAGAAGAACTCCTACAGACGCTCCAGACAGGCGTCGCCTCCAAGAACGGCCAAGACAACGGCTACCAA
GGCCAACTTCAGGACGCGCGGAACCGAGCCACAGCAGCAGCCACAGAGCAAGAACAAGCCAAGATCAAAATCAAC
CATCTGCAAAGCCGGCTCAAGGAAGAGGAACCGCGAGCCAAGAAGGCAAAGGAGCAAAACGCCGGTCTGCTACGT
GATCTCGACGGCATGCGCTCGCAGGCACGCAAACTCGAGAGCGAACTCGGCAAGCTCGGACTTCAGCCTGGCCGC
GGCGAAGACCTGTATAAGCAGGAATCAGACCTCAAGGAGACGGTCCGCGGCCTGCGAGAAGAAGCCGACAAGGTC
AAGCGGCAGGTAGCCAACTTGGACTTTAGCTACACCGATCCCGTCGCCGGCTTCGACCGATCCAAGGTCAAGGGT
CTGGTTGCCCAACTCTTCACGCTGGGCGAGCAGCACACACGCGCAGGCACCGCTCTCGAGATCTGCGCGGGAGGC
CGTCTCTACAACGTGGTGGTAGACAGCGAAGTGACAGGAACCCAGCTGCTTCAACGAGGCAAGCTCCGGAAGCGA
GTAACCATCATCCCGCTCAACAAGATCGCCGCCTTCAAGGCCTCAGCCCAGACGCTGGCAATGGCGCAAAGAATG
GCTCCCGGAAAGGTCGACCTCGCCTTGTCGCTGGTCGGATACGATGACGAAGTGTCGGCCGCCATGGAGTATGTC
TTTGGCAATACGCTCGTTTGCGCCGATGCCGAGACGGCCAAGCGCGTCACCTTTGATCCCAACATTCGGATGAGG
AGTATTACGCTCGAGGGAGACGCGTATGATCCGTCGGGGACTCTTTCAGGGGGCAGCGCTCCCAGTTCGAGCGGC
GTGCTCGTCACGCTTCAGAAGCTCAACAGCCTAACAAGACGACTGGAAGAGGCCGAGAAGTCCCTGTGCGAGGTT
CAGGCCAGTATCGCTCGAGACAAGTCCAAGCTAGACCAGGCCCGACGCATCGAGCAAGATTTAGACCTCAAGACT
CACGAGATCAAGCTGGCCGAGGATCAAATCAGCAACAACTCGTCATCGTCCATCATCCAAGAAGTCGACAAGATC
AAGACCACAATGGCCGAACTCCGAACCAGCATCGAGGAAGCCAAAGCCCGCCAGTCAGGAGCCAACGCGCAAGCC
AAGCAGATAGAAAAGGACATCAACGAGTTCGATACCAACAAAGACGCCAAGCTCATCCAGCTCCAAAAGTCTCTC
GACAAGCTCCGAGCCAGCCTGGATAAAGACTCAGCCACCGTCAAAGCCCTCCAGAAGGAACTCCAAGGCGCACAG
CTCGACGTCGAGCAAGTAGGCACCGACCTCTCCGCCGCCCGCGACCAACTCCAGGAAGCCGACATGGCCATCCGC
GCCCAGCAGCGAGACGTCGAGGGTCTAGCCCAGCAGCGAAGCCAGGTAAGCGAGACGCACGACGCAGCACAGGCC
CAACTCGACGACGAGAGAGCCAAGCTCCACCTCTTCGACGACGAACTCCGCGCGCTCGACGAGGCCGTCCGATCC
AAGAACGCGCGCATCGCCGAGGACGGACTCGAGATGCAGAAGCTCGGCCACCAGCTAGAGCGCTTCCACAAGGAG
CGCCAGGCGGCAGCCGACAACGTCTCCCGCCTCGAGTCGGAGCACGAATGGATCGCCGACGAAAAGGACAAGCTG
GGCAGGCCCGGAACCGCCTACGATTTCCAGGGCCAGAACATTGGCGAGTGCAAGGCGACGCTGCGCAACTTGACG
GATCGCTTCCAAGGAATGCGAAAGAAGATCAACCCAAAGGTTATGAACATGATTGATAGCGTCGAGAAGAAGGAA
GTCTCGCTCAAGCACATGGTCAAGACGGTCATCCGCGACAAGCGAAAGATCGAGGAGACCATCGTCAGCCTAGAC
GAGTACAAGAAGAAGGCTCTGCACAAGACGTGGGAAAAGGTCAATGGCGACTTTGGCAACATCTTTTCCGAGCTG
CTTCCCGGCGGCAGCTTCGCCAAGCTGGATCCTCCAGAGGGCAAGACCATCAGTGACGGCCTCGAGGTCAAGGTC
TGCCTGGGCAAGGTCTGGAAGCAGAGCCTGACGGAGCTGAGCGGTGGTCAACGCTCCCTCGTCGCCCTCTCCCTC
ATCATGGCCCTGCTGCAGTTCAAGCCGGCGCCCATGTACATCCTCGACGAGGTCGACGCCGCGCTCGACCTCTCC
CACACGCAAAACATCGGCCGTCTCATTAGGACGCGCTTCAAGGGCTCGCAGTTCATCGTCGTCAGCCTCAAGGAC
GGCATGTTCCAGAACGCGAACCGCATCTTCCGCACGCGTTTTAGCGAGGGCACCAGTATGGTCCAGGCCTTGACG
CCGGCGGACCTGAAATGA
Transcript >Ophun1|1975
ATGAGGGTGGTGGAAGTCATCATCGACGGCTTCAAGTCGTACGCCGTACGCACCATCATATCGGGATGGGACGAA
AGCTTCAACTCCATCACCGGCCTCAACGGCAGCGGGAAATCCAACATCCTCGACGCGATATGCTTCGTTCTCGGT
ATCACCAACATGTCTACAGTCCGAGCGCAAAACCTGCAGGACCTGATCTATAAACGCGGTCAAGCCGGTGTGACC
AAAGCCAGCGTGACAATCGTCTTCGAGAACCGCGACAAGAAGAAATCCCCCATCGGATTCGAGCAATACGTCGCC
ATCAGCGTCACCCGCCAGATTGTCCTCGGCGGAACCTCAAAATACCTCATCAACGGCCACCGAGCCCAGCAGCAA
ACAGTCCAAAACCTCTTCCAGTCGGTACAACTCAACATCAACAACCCCAACTTCCTCATCATGCAGGGCCGCATC
ACAAAAGTCCTCAACATGAAGGCCGTCGAGATACTAGCCATGATCGAAGAAGCAGCAGGCACGCGAATGTTTGAA
GATCGGAGAGACAAGGCGCTCAAGACGATGGCAAAGAAGGAGCTCAAGCTGCAGGAACTCCGCGAGCTCCTCAAG
GACGAAATCGAGCCCAAGCTGGAAAAGCTCCGTACCGAGAAGCGAGCCTTTCTCGACTTCCAACAGACGCAAAAC
GACCTCGAACGGCTCACGAGACTAGTTGTCGCTTACGACTACGTCCGCTGCCAGGAGAAACTCAAGCAATCGGCA
GCAGACCTCGAAGGCAAGAAGCAGCGTCAGAAAGATCTCGAGAGTGCAGTAACTCGCCTCCGCAGCGAAATATCC
CACCTGGAAGAGGACATTGGCCGGGTGCGTGCCGAGCGCGACAAGGAGCTCCGAAAGGGCGGCAAAGCCCAAGCA
CTAGAAGAGGCCGTCAAGAAGCAGGCCAACGAGCTCGTGCGCCTCGCCACCGTCATGGACCTGAAGAACACGAGT
CTGGCGGAGGAAACGGAGAAGAAGAAGGCGGTGGAGAAGACGGTATCCGAGATGGAAGCCGCCCTCAAAGTCAAG
ACAGCCGCCTTCGAAACTGCCCAGTCGACATACACGGCAGCAAAAGACGAGCTCCAGAAGCAAAGCCACGAGGTC
GAATCCAAAGAAGAACTCCTACAGACGCTCCAGACAGGCGTCGCCTCCAAGAACGGCCAAGACAACGGCTACCAA
GGCCAACTTCAGGACGCGCGGAACCGAGCCACAGCAGCAGCCACAGAGCAAGAACAAGCCAAGATCAAAATCAAC
CATCTGCAAAGCCGGCTCAAGGAAGAGGAACCGCGAGCCAAGAAGGCAAAGGAGCAAAACGCCGGTCTGCTACGT
GATCTCGACGGCATGCGCTCGCAGGCACGCAAACTCGAGAGCGAACTCGGCAAGCTCGGACTTCAGCCTGGCCGC
GGCGAAGACCTGTATAAGCAGGAATCAGACCTCAAGGAGACGGTCCGCGGCCTGCGAGAAGAAGCCGACAAGGTC
AAGCGGCAGGTAGCCAACTTGGACTTTAGCTACACCGATCCCGTCGCCGGCTTCGACCGATCCAAGGTCAAGGGT
CTGGTTGCCCAACTCTTCACGCTGGGCGAGCAGCACACACGCGCAGGCACCGCTCTCGAGATCTGCGCGGGAGGC
CGTCTCTACAACGTGGTGGTAGACAGCGAAGTGACAGGAACCCAGCTGCTTCAACGAGGCAAGCTCCGGAAGCGA
GTAACCATCATCCCGCTCAACAAGATCGCCGCCTTCAAGGCCTCAGCCCAGACGCTGGCAATGGCGCAAAGAATG
GCTCCCGGAAAGGTCGACCTCGCCTTGTCGCTGGTCGGATACGATGACGAAGTGTCGGCCGCCATGGAGTATGTC
TTTGGCAATACGCTCGTTTGCGCCGATGCCGAGACGGCCAAGCGCGTCACCTTTGATCCCAACATTCGGATGAGG
AGTATTACGCTCGAGGGAGACGCGTATGATCCGTCGGGGACTCTTTCAGGGGGCAGCGCTCCCAGTTCGAGCGGC
GTGCTCGTCACGCTTCAGAAGCTCAACAGCCTAACAAGACGACTGGAAGAGGCCGAGAAGTCCCTGTGCGAGGTT
CAGGCCAGTATCGCTCGAGACAAGTCCAAGCTAGACCAGGCCCGACGCATCGAGCAAGATTTAGACCTCAAGACT
CACGAGATCAAGCTGGCCGAGGATCAAATCAGCAACAACTCGTCATCGTCCATCATCCAAGAAGTCGACAAGATC
AAGACCACAATGGCCGAACTCCGAACCAGCATCGAGGAAGCCAAAGCCCGCCAGTCAGGAGCCAACGCGCAAGCC
AAGCAGATAGAAAAGGACATCAACGAGTTCGATACCAACAAAGACGCCAAGCTCATCCAGCTCCAAAAGTCTCTC
GACAAGCTCCGAGCCAGCCTGGATAAAGACTCAGCCACCGTCAAAGCCCTCCAGAAGGAACTCCAAGGCGCACAG
CTCGACGTCGAGCAAGTAGGCACCGACCTCTCCGCCGCCCGCGACCAACTCCAGGAAGCCGACATGGCCATCCGC
GCCCAGCAGCGAGACGTCGAGGGTCTAGCCCAGCAGCGAAGCCAGGTAAGCGAGACGCACGACGCAGCACAGGCC
CAACTCGACGACGAGAGAGCCAAGCTCCACCTCTTCGACGACGAACTCCGCGCGCTCGACGAGGCCGTCCGATCC
AAGAACGCGCGCATCGCCGAGGACGGACTCGAGATGCAGAAGCTCGGCCACCAGCTAGAGCGCTTCCACAAGGAG
CGCCAGGCGGCAGCCGACAACGTCTCCCGCCTCGAGTCGGAGCACGAATGGATCGCCGACGAAAAGGACAAGCTG
GGCAGGCCCGGAACCGCCTACGATTTCCAGGGCCAGAACATTGGCGAGTGCAAGGCGACGCTGCGCAACTTGACG
GATCGCTTCCAAGGAATGCGAAAGAAGATCAACCCAAAGGTTATGAACATGATTGATAGCGTCGAGAAGAAGGAA
GTCTCGCTCAAGCACATGGTCAAGACGGTCATCCGCGACAAGCGAAAGATCGAGGAGACCATCGTCAGCCTAGAC
GAGTACAAGAAGAAGGCTCTGCACAAGACGTGGGAAAAGGTCAATGGCGACTTTGGCAACATCTTTTCCGAGCTG
CTTCCCGGCGGCAGCTTCGCCAAGCTGGATCCTCCAGAGGGCAAGACCATCAGTGACGGCCTCGAGGTCAAGGTC
TGCCTGGGCAAGGTCTGGAAGCAGAGCCTGACGGAGCTGAGCGGTGGTCAACGCTCCCTCGTCGCCCTCTCCCTC
ATCATGGCCCTGCTGCAGTTCAAGCCGGCGCCCATGTACATCCTCGACGAGGTCGACGCCGCGCTCGACCTCTCC
CACACGCAAAACATCGGCCGTCTCATTAGGACGCGCTTCAAGGGCTCGCAGTTCATCGTCGTCAGCCTCAAGGAC
GGCATGTTCCAGAACGCGAACCGCATCTTCCGCACGCGTTTTAGCGAGGGCACCAGTATGGTCCAGGCCTTGACG
CCGGCGGACCTGAAATGA
Gene >Ophun1|1975
ATGAGGGTGGTGGAAGTCATCATCGACGTATGTGACTGCTTCATATTGCTTTTCATTGCAAGGCTAAACCTCCTC
CTAGGGCTTCAAGTCGTACGCCGTACGCACCATCATATCGGGATGGTAGGTTGGATTCTTCCGTCGAAAACAAGA
TGGCTGACCTCTAGCAGGGACGAAAGCTTCAACTCCATCACCGGCCTCAACGGCAGCGGGAAATCCAACATCCTC
GACGCGATATGCTTCGTTCTCGGTATCACCAACATGTCTACAGTCCGAGCGCAAAACCTGCAGGTACGACAGAGA
AACGACGTCTCTCGATATGCCCGCTGAAGCTGACGACGCGCAGGACCTGATCTATAAACGCGGTCAAGCCGGTGT
GACCAAAGCCAGCGTGACAATCGTCTTCGAGAACCGCGACAAGAAGAAATCCCCCATCGGATTCGAGCAATACGT
CGCCATCAGCGTCACCCGCCAGATTGTCCTCGGCGGAACCTCAAAATACCTCATCAACGGCCACCGAGCCCAGCA
GCAAACAGTCCAAAACCTCTTCCAGTCGGTACAACTCAACATCAACAACCCCAACTTCCTCATCATGCAGGGCCG
CATCACAAAAGTCCTCAACATGAAGGCCGTCGAGATACTAGCCATGATCGAAGAAGCAGCAGGCACGCGAATGTT
TGAAGATCGGAGAGACAAGGCGCTCAAGACGATGGCAAAGAAGGAGCTCAAGCTGCAGGAACTCCGCGAGCTCCT
CAAGGACGAAATCGAGCCCAAGCTGGAAAAGCTCCGTACCGAGAAGCGAGCCTTTCTCGACTTCCAACAGACGCA
AAACGACCTCGAACGGCTCACGAGACTAGTTGTCGCTTACGACTACGTCCGCTGCCAGGAGAAACTCAAGCAATC
GGCAGCAGACCTCGAAGGCAAGAAGCAGCGTCAGAAAGATCTCGAGAGTGCAGTAACTCGCCTCCGCAGCGAAAT
ATCCCACCTGGAAGAGGACATTGGCCGGGTGCGTGCCGAGCGCGACAAGGAGCTCCGAAAGGGCGGCAAAGCCCA
AGCACTAGAAGAGGCCGTCAAGAAGCAGGCCAACGAGCTCGTGCGCCTCGCCACCGTCATGGACCTGAAGAACAC
GAGTCTGGCGGAGGAAACGGAGAAGAAGAAGGCGGTGGAGAAGACGGTATCCGAGATGGAAGCCGCCCTCAAAGT
CAAGACAGCCGCCTTCGAAACTGCCCAGTCGACATACACGGCAGCAAAAGACGAGCTCCAGAAGCAAAGCCACGA
GGTCGAATCCAAAGAAGAACTCCTACAGACGCTCCAGACAGGCGTCGCCTCCAAGAACGGCCAAGACAACGGCTA
CCAAGGCCAACTTCAGGACGCGCGGAACCGAGCCACAGCAGCAGCCACAGAGCAAGAACAAGCCAAGATCAAAAT
CAACCATCTGCAAAGCCGGCTCAAGGAAGAGGAACCGCGAGCCAAGAAGGCAAAGGAGCAAAACGCCGGTCTGCT
ACGTGATCTCGACGGCATGCGCTCGCAGGCACGCAAACTCGAGAGCGAACTCGGCAAGCTCGGACTTCAGCCTGG
CCGCGGCGAAGACCTGTATAAGCAGGAATCAGACCTCAAGGAGACGGTCCGCGGCCTGCGAGAAGAAGCCGACAA
GGTCAAGCGGCAGGTAGCCAACTTGGACTTTAGCTACACCGATCCCGTCGCCGGCTTCGACCGATCCAAGGTCAA
GGGTCTGGTTGCCCAACTCTTCACGCTGGGCGAGCAGCACACACGCGCAGGCACCGCTCTCGAGATCTGCGCGGG
AGGCCGTCTCTACAACGTGGTGGTAGACAGCGAAGTGACAGGAACCCAGCTGCTTCAACGAGGCAAGCTCCGGAA
GCGAGTAACCATCATCCCGCTCAACAAGATCGCCGCCTTCAAGGCCTCAGCCCAGACGCTGGCAATGGCGCAAAG
AATGGCTCCCGGAAAGGTCGACCTCGCCTTGTCGCTGGTCGGATACGATGACGAAGTGTCGGCCGCCATGGAGTA
TGTCTTTGGCAATACGCTCGTTTGCGCCGATGCCGAGACGGCCAAGCGCGTCACCTTTGATCCCAACATTCGGAT
GAGGAGTATTACGCTCGAGGGAGACGCGTATGATCCGTCGGGGACTCTTTCAGGGGGCAGCGCTCCCAGTTCGAG
CGGCGTGCTCGTCACGCTTCAGAAGCTCAACAGCCTAACAAGACGACTGGAAGAGGCCGAGAAGTCCCTGTGCGA
GGTTCAGGCCAGTATCGCTCGAGACAAGTCCAAGCTAGACCAGGCCCGACGCATCGAGCAAGATTTAGACCTCAA
GACTCACGAGATCAAGCTGGCCGAGGATCAAATCAGCAACAACTCGTCATCGTCCATCATCCAAGAAGTCGACAA
GATCAAGACCACAATGGCCGAACTCCGAACCAGCATCGAGGAAGCCAAAGCCCGCCAGTCAGGAGCCAACGCGCA
AGCCAAGCAGATAGAAAAGGACATCAACGAGTTCGATACCAACAAAGACGCCAAGCTCATCCAGCTCCAAAAGTC
TCTCGACAAGCTCCGAGCCAGCCTGGATAAAGACTCAGCCACCGTCAAAGCCCTCCAGAAGGAACTCCAAGGCGC
ACAGCTCGACGTCGAGCAAGTAGGCACCGACCTCTCCGCCGCCCGCGACCAACTCCAGGAAGCCGACATGGCCAT
CCGCGCCCAGCAGCGAGACGTCGAGGGTCTAGCCCAGCAGCGAAGCCAGGTAAGCGAGACGCACGACGCAGCACA
GGCCCAACTCGACGACGAGAGAGCCAAGCTCCACCTCTTCGACGACGAACTCCGCGCGCTCGACGAGGCCGTCCG
ATCCAAGAACGCGCGCATCGCCGAGGACGGACTCGAGATGCAGAAGCTCGGCCACCAGCTAGAGCGCTTCCACAA
GGAGCGCCAGGCGGCAGCCGACAACGTCTCCCGCCTCGAGTCGGAGCACGAATGGATCGCCGACGAAAAGGACAA
GCTGGGCAGGCCCGGAACCGCCTACGATTTCCAGGGCCAGAACATTGGCGAGTGCAAGGCGACGCTGCGCAACTT
GACGGATCGCTTCCAAGGAATGCGAAAGAAGATCAACCCAAAGGTTATGAACATGATTGATAGCGTCGAGAAGAA
GGAAGTCTCGCTCAAGCACATGGTCAAGACGGTCATCCGCGACAAGCGAAAGATCGAGGAGACCATCGTCAGCCT
AGACGAGTACAAGAAGAAGGCTCTGCACAAGACGTGGGAAAAGGTCAATGGCGACTTTGGCAACATCTTTTCCGA
GCTGCTTCCCGGCGGCAGCTTCGCCAAGCTGGATCCTCCAGAGGGCAAGACCATCAGTGACGGCCTCGAGGTCAA
GGTCTGCCTGGGCAAGGTCTGGAAGCAGAGCCTGACGGAGCTGAGCGGTGGTCAACGGTAGCTCTCTCTCTCTCC
CCTCCCTCTACCCATCTTTCTCGTGATATCCCCAAACTCACCCTCTTCTCACCACAGCTCCCTCGTCGCCCTCTC
CCTCATCATGGCCCTGCTGCAGTTCAAGCCGGCGCCCATGTACATCCTCGACGAGGTCGACGCCGCGCTCGACCT
CTCCCACACGCAAAACATCGGCCGTCTCATTAGGACGCGCTTCAAGGGCTCGCAGTTCATCGTCGTCAGCCTCAA
GGACGGCATGTTCCAGAACGCGAACCGCATCTTCCGCACGCGTTTTAGCGAGGGCACCAGTATGGTCCAGGCCTT
GACGCCGGCGGACCTGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail