Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1972
Gene name
LocationContig_19:44859..46296
Strand+
Gene length (bp)1437
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03637 Mob1_phocein Mob1/phocein family 5.1E-25 102 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34349|YK83_CAEEL Uncharacterized protein C30A5.3 OS=Caenorhabditis elegans GN=C30A5.3 PE=4 SV=2 45 266 1.0E-30
sp|Q9QYW3|PHOCN_RAT MOB-like protein phocein OS=Rattus norvegicus GN=Mob4 PE=1 SV=1 50 266 4.0E-29
sp|Q5RDB1|PHOCN_PONAB MOB-like protein phocein OS=Pongo abelii GN=MOB4 PE=2 SV=2 50 266 4.0E-29
sp|Q6PEB6|PHOCN_MOUSE MOB-like protein phocein OS=Mus musculus GN=Mob4 PE=1 SV=1 50 266 4.0E-29
sp|Q9Y3A3|PHOCN_HUMAN MOB-like protein phocein OS=Homo sapiens GN=MOB4 PE=1 SV=1 50 266 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34349|YK83_CAEEL Uncharacterized protein C30A5.3 OS=Caenorhabditis elegans GN=C30A5.3 PE=4 SV=2 45 266 1.0E-30
sp|Q9QYW3|PHOCN_RAT MOB-like protein phocein OS=Rattus norvegicus GN=Mob4 PE=1 SV=1 50 266 4.0E-29
sp|Q5RDB1|PHOCN_PONAB MOB-like protein phocein OS=Pongo abelii GN=MOB4 PE=2 SV=2 50 266 4.0E-29
sp|Q6PEB6|PHOCN_MOUSE MOB-like protein phocein OS=Mus musculus GN=Mob4 PE=1 SV=1 50 266 4.0E-29
sp|Q9Y3A3|PHOCN_HUMAN MOB-like protein phocein OS=Homo sapiens GN=MOB4 PE=1 SV=1 50 266 4.0E-29
sp|Q7K0E3|MOB4_DROME MOB kinase activator-like 4 OS=Drosophila melanogaster GN=Mob4 PE=2 SV=1 50 266 5.0E-29
sp|Q5F495|PHOCN_CHICK MOB-like protein phocein OS=Gallus gallus GN=MOB4 PE=2 SV=1 50 266 7.0E-29
sp|O94360|MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob1 PE=1 SV=1 87 263 9.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2482
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6054
Ophiocordyceps australis map64 (Brazil) OphauB2|2746
Ophiocordyceps camponoti-floridani Ophcf2|04022
Ophiocordyceps camponoti-rufipedis Ophun1|1972 (this protein)
Ophiocordyceps kimflemingae Ophio5|5849
Ophiocordyceps subramaniannii Hirsu2|3581

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1972
MALAPSSPRLPSPPPAAEIQIGPKSPSGGTTVSPQAMQMEQTVLDARSKRRIHPGTKAADMAAGPPLVPLGELDS
AFQLQEHLSALHYHYTASATQAITRETALQLAHPPPGIDRSLWLYELCRFLIAQCNSLIVGFLFDDPPCCAETCP
EMRASEWQFLCAVHEQPKSCCAIDYCCHTLDWAANVVSDQKIFPSRFVALSDSPSKNVGVKNLINVFRRLHRIFA
HAWFQHRTVFWTVEGQAGLYVFFKTVCDLYDLLPSENYKLPPEAEGLEAPTTEPEPQRPTPTILKPPLQHGDDDG
LHSIGRTNTRRHIRSSPSTGSAVTTVLETDEEDADAACSKMRDLDLSEQDQAAEDEPEMAEVPVIVEQCELIDAI
ASDSSDSEDLPMTEAEKTASIKADEELDETTDASNVVPGASSPEHAAHAGPPPGLDPQPGSPLASTEHPEDSVES
KGEVEKAVSETS*
Coding >Ophun1|1972
ATGGCCTTGGCTCCGAGCTCGCCTCGTCTTCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCCGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGATATGGCAGCCGGACCGCCTCTGGTTCCTCTGGGCGAGCTCGACTCT
GCCTTTCAGCTCCAAGAGCATCTCTCGGCCTTGCACTACCACTACACAGCTTCCGCCACGCAGGCCATTACCCGC
GAAACGGCCCTTCAACTGGCCCATCCCCCGCCAGGAATCGACCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTC
CTCATCGCACAGTGCAATTCGCTCATCGTCGGCTTCTTATTCGATGATCCGCCCTGCTGCGCTGAAACATGCCCC
GAGATGCGAGCGTCCGAGTGGCAGTTCCTGTGCGCCGTCCACGAACAGCCCAAGAGCTGTTGCGCCATCGACTAC
TGCTGTCATACTCTCGATTGGGCCGCCAATGTCGTGTCCGATCAAAAGATATTTCCCAGTAGATTCGTCGCCCTC
AGCGACAGCCCTAGCAAGAACGTGGGCGTGAAGAACTTGATCAACGTTTTTCGAAGATTGCATAGGATATTCGCA
CACGCCTGGTTCCAGCACCGCACCGTCTTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAGACC
GTTTGCGATCTGTACGACCTGCTGCCCTCCGAAAATTACAAACTCCCGCCGGAGGCCGAGGGATTGGAAGCTCCG
ACAACCGAACCCGAGCCTCAGAGGCCCACGCCAACCATCTTGAAGCCGCCGTTGCAACACGGGGATGACGATGGT
CTGCACTCTATTGGCCGCACCAACACCCGGAGGCATATCCGGAGCAGTCCCTCAACCGGAAGTGCAGTGACGACA
GTCCTTGAGACGGACGAGGAAGACGCGGATGCCGCCTGCAGCAAGATGCGCGACCTGGACTTGTCAGAACAAGAC
CAGGCTGCAGAAGACGAGCCCGAAATGGCTGAGGTCCCGGTCATTGTTGAGCAGTGCGAGCTCATCGACGCGATT
GCATCAGACTCGAGCGACTCAGAGGATCTACCGATGACAGAAGCTGAGAAAACAGCCTCCATCAAGGCAGATGAA
GAGCTGGATGAGACAACTGATGCCTCCAACGTGGTCCCAGGAGCGTCTTCTCCTGAACACGCCGCCCATGCTGGC
CCTCCGCCGGGGCTCGACCCACAGCCGGGATCCCCACTGGCATCGACAGAGCATCCCGAGGACTCAGTCGAGTCG
AAAGGAGAAGTCGAAAAAGCGGTCAGCGAGACATCCTAG
Transcript >Ophun1|1972
ATGGCCTTGGCTCCGAGCTCGCCTCGTCTTCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCCGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGATATGGCAGCCGGACCGCCTCTGGTTCCTCTGGGCGAGCTCGACTCT
GCCTTTCAGCTCCAAGAGCATCTCTCGGCCTTGCACTACCACTACACAGCTTCCGCCACGCAGGCCATTACCCGC
GAAACGGCCCTTCAACTGGCCCATCCCCCGCCAGGAATCGACCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTC
CTCATCGCACAGTGCAATTCGCTCATCGTCGGCTTCTTATTCGATGATCCGCCCTGCTGCGCTGAAACATGCCCC
GAGATGCGAGCGTCCGAGTGGCAGTTCCTGTGCGCCGTCCACGAACAGCCCAAGAGCTGTTGCGCCATCGACTAC
TGCTGTCATACTCTCGATTGGGCCGCCAATGTCGTGTCCGATCAAAAGATATTTCCCAGTAGATTCGTCGCCCTC
AGCGACAGCCCTAGCAAGAACGTGGGCGTGAAGAACTTGATCAACGTTTTTCGAAGATTGCATAGGATATTCGCA
CACGCCTGGTTCCAGCACCGCACCGTCTTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAGACC
GTTTGCGATCTGTACGACCTGCTGCCCTCCGAAAATTACAAACTCCCGCCGGAGGCCGAGGGATTGGAAGCTCCG
ACAACCGAACCCGAGCCTCAGAGGCCCACGCCAACCATCTTGAAGCCGCCGTTGCAACACGGGGATGACGATGGT
CTGCACTCTATTGGCCGCACCAACACCCGGAGGCATATCCGGAGCAGTCCCTCAACCGGAAGTGCAGTGACGACA
GTCCTTGAGACGGACGAGGAAGACGCGGATGCCGCCTGCAGCAAGATGCGCGACCTGGACTTGTCAGAACAAGAC
CAGGCTGCAGAAGACGAGCCCGAAATGGCTGAGGTCCCGGTCATTGTTGAGCAGTGCGAGCTCATCGACGCGATT
GCATCAGACTCGAGCGACTCAGAGGATCTACCGATGACAGAAGCTGAGAAAACAGCCTCCATCAAGGCAGATGAA
GAGCTGGATGAGACAACTGATGCCTCCAACGTGGTCCCAGGAGCGTCTTCTCCTGAACACGCCGCCCATGCTGGC
CCTCCGCCGGGGCTCGACCCACAGCCGGGATCCCCACTGGCATCGACAGAGCATCCCGAGGACTCAGTCGAGTCG
AAAGGAGAAGTCGAAAAAGCGGTCAGCGAGACATCCTAG
Gene >Ophun1|1972
ATGGCCTTGGCTCCGAGCTCGCCTCGTCTTCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCCGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGATATGGCAGCCGGACCGCCTCTGGTTCCTCTGGGCGAGGTAAGACGG
GGTTTTCTCCCCTCAGCTACTGGGCTAATCTCCCTCCAGCTCGACTCTGCCTTTCAGCTCCAAGAGCATCTCTCG
GCCTTGCACTACCACTACACAGCTTCCGCCACGCAGGCCATTACCCGCGAAACGGCCCTTCAACTGGCCCATCCC
CCGCCAGGAATCGACCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTCCTCATCGCACAGTGCAATTCGCTCATC
GTCGGCTTCTTATTCGATGATCCGCCCTGCTGCGCTGAAACATGCCCCGAGATGCGAGCGTCCGAGTGGCAGTTC
CTGTGCGCCGTCCACGAACAGCCCAAGAGCTGTTGCGCCATCGACTACTGCTGTCATACTCTCGATTGGGCCGCC
AATGTCGTGTCCGATCAAAAGATATTTCCCAGTAGATTCGTCGCCCTCAGCGACAGCCCTAGCAAGAACGTGGGC
GTGAAGAACTTGATCAACGTTTTTCGAAGATTGCATAGGATATTCGCACACGCCTGGTTCCAGCACCGCACCGTC
TTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAGACCGTTTGCGATCTGTACGACCTGCTGCCC
TCCGAAAATTACAAACTCCCGCCGGAGGCCGAGGGATTGGAAGCTCCGACAACCGAACCCGAGCCTCAGAGGCCC
ACGCCAACCATCTTGAAGCCGCCGTTGCAACACGGGGATGACGATGGTCTGCACTCTATTGGCCGCACCAACACC
CGGAGGCATATCCGGAGCAGTCCCTCAACCGGAAGTGCAGTGACGACAGTCCTTGAGACGGACGAGGAAGACGCG
GATGCCGCCTGCAGCAAGATGCGCGACCTGGACTTGTCAGAACAAGACCAGGCTGCAGAAGACGAGCCCGAAATG
GCTGAGGTCCCGGTCATTGTTGAGCAGTGCGAGCTCATCGACGCGATTGCATCAGACTCGAGCGACTCAGAGGAT
CTACCGATGACAGAAGCTGAGAAAACAGCCTCCATCAAGGCAGATGAAGAGCTGGATGAGACAACTGATGCCTCC
AACGTGGTCCCAGGAGCGTCTTCTCCTGAACACGCCGCCCATGCTGGCCCTCCGCCGGGGCTCGACCCACAGCCG
GGATCCCCACTGGCATCGACAGAGCATCCCGAGGACTCAGTCGAGTCGAAAGGAGAAGTCGAAAAAGCGGTCAGC
GAGACATCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail