Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1971
Gene name
LocationContig_19:43187..44594
Strand-
Gene length (bp)1407
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 5.6E-30 30 196
PF07683 CobW_C Cobalamin synthesis protein cobW C-terminal domain 2.6E-05 279 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=1 SV=1 30 343 2.0E-65
sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 30 343 4.0E-65
sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 7 339 6.0E-64
sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 7 339 9.0E-64
sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 30 344 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=1 SV=1 30 343 2.0E-65
sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 30 343 4.0E-65
sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 7 339 6.0E-64
sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 7 339 9.0E-64
sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 30 344 1.0E-63
sp|Q5JTY5|CBWD3_HUMAN COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=2 SV=1 7 339 2.0E-61
sp|Q5RIA9|CBWD5_HUMAN COBW domain-containing protein 5 OS=Homo sapiens GN=CBWD5 PE=2 SV=1 7 339 6.0E-61
sp|Q4V339|CBWD6_HUMAN COBW domain-containing protein 6 OS=Homo sapiens GN=CBWD6 PE=3 SV=1 7 339 2.0E-60
sp|O74310|YOG5_SCHPO COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.05 PE=3 SV=1 30 330 2.0E-53
sp|A6NM15|CBWD7_HUMAN Putative COBW domain-containing protein 7 OS=Homo sapiens GN=CBWD7 PE=5 SV=3 105 339 6.0E-26
sp|P94400|YCIC_BACSU Putative metal chaperone YciC OS=Bacillus subtilis (strain 168) GN=yciC PE=2 SV=1 54 206 8.0E-17
sp|P31521|P47K_PSECL 47 kDa protein OS=Pseudomonas chlororaphis PE=3 SV=1 22 218 9.0E-15
sp|Q9HZQ2|COBW_PSEAE Protein CobW OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobW PE=3 SV=1 29 187 2.0E-14
sp|Q869Q0|Y4527_DICDI COBW domain-containing protein DDB_G0274527 OS=Dictyostelium discoideum GN=DDB_G0274527 PE=3 SV=1 38 205 3.0E-14
sp|P24203|YJIA_ECOLI Uncharacterized GTP-binding protein YjiA OS=Escherichia coli (strain K12) GN=yjiA PE=1 SV=3 61 339 4.0E-12
sp|P29937|COBW_PSEDE Protein CobW OS=Pseudomonas denitrificans GN=cobW PE=3 SV=3 30 189 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2481
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6055
Ophiocordyceps australis map64 (Brazil) OphauB2|2745
Ophiocordyceps camponoti-floridani Ophcf2|04023
Ophiocordyceps camponoti-rufipedis Ophun1|1971 (this protein)
Ophiocordyceps kimflemingae Ophio5|5848
Ophiocordyceps subramaniannii Hirsu2|3580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1971
MEPDGDAPPDLVDTAEELQAELSVKVPITIVTEFGDSLDIEKSLTVNKGEEKFEEWLEVGNGCICCSVKDTGVNA
IESLMSKKGAFDYILLETTGLADPGNIAPLFWVDDGLGSTIYLDGIVTLVDARNILRSLEDASGQVDEHELHGHK
GPLMTTAHLQISHADVVVINKADLVNEEELRLVRERVESINGLARVHVTERSVVPQLEGFLLDLHAYDEFNESDF
AAKGHSHLDPIQAISTICVPVPRLQPHQLVLVDAWLRELLWENRVPGSHEQGDFEVHRSKGRIVLENGEARMLQG
VREVFELSEPPDGGEAQPADGKMIFIGRRLAEAGLADSFRRALQNS*
Coding >Ophun1|1971
ATGGAGCCCGATGGAGACGCCCCTCCCGATTTGGTGGACACCGCGGAGGAGCTGCAAGCCGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGAGTTTGGCGACTCCCTGGATATTGAGAAGTCCTTGACTGTCAACAAAGGCGAA
GAAAAGTTTGAGGAGTGGCTCGAAGTCGGAAATGGCTGTATATGCTGTTCCGTCAAAGACACCGGAGTCAATGCC
ATCGAGTCCCTTATGAGCAAGAAAGGCGCCTTTGACTACATTCTACTGGAGACTACCGGTCTTGCCGATCCCGGA
AACATTGCTCCTCTCTTCTGGGTGGATGACGGCCTGGGAAGCACGATATACCTCGATGGAATCGTCACTCTGGTT
GACGCCAGAAATATCCTGCGCAGCCTGGAAGATGCGAGCGGCCAGGTGGACGAGCATGAGCTGCACGGCCACAAG
GGTCCGTTAATGACGACGGCGCACCTTCAGATCTCACATGCAGATGTCGTCGTCATCAATAAGGCAGATCTGGTC
AACGAAGAGGAGCTTCGTCTGGTAAGAGAACGCGTCGAATCTATCAATGGGCTCGCAAGGGTGCATGTGACAGAG
CGGAGCGTCGTCCCGCAGCTGGAAGGCTTTCTGTTGGACCTGCACGCCTATGACGAATTCAATGAAAGCGATTTC
GCAGCCAAGGGGCATAGCCACCTGGACCCGATACAGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGACTGCAG
CCGCATCAACTGGTCCTGGTTGATGCCTGGCTGCGAGAATTGCTCTGGGAGAACAGGGTTCCGGGCTCACACGAA
CAGGGGGACTTTGAGGTTCACCGTTCCAAGGGCCGTATTGTCCTTGAAAACGGGGAGGCTAGGATGCTTCAGGGC
GTCAGAGAGGTGTTTGAACTATCGGAGCCGCCAGACGGCGGGGAGGCACAGCCAGCTGATGGCAAGATGATCTTC
ATCGGAAGGCGGCTGGCAGAAGCGGGCTTGGCGGATAGTTTCAGAAGAGCTTTGCAGAATAGCTGA
Transcript >Ophun1|1971
ATGGAGCCCGATGGAGACGCCCCTCCCGATTTGGTGGACACCGCGGAGGAGCTGCAAGCCGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGAGTTTGGCGACTCCCTGGATATTGAGAAGTCCTTGACTGTCAACAAAGGCGAA
GAAAAGTTTGAGGAGTGGCTCGAAGTCGGAAATGGCTGTATATGCTGTTCCGTCAAAGACACCGGAGTCAATGCC
ATCGAGTCCCTTATGAGCAAGAAAGGCGCCTTTGACTACATTCTACTGGAGACTACCGGTCTTGCCGATCCCGGA
AACATTGCTCCTCTCTTCTGGGTGGATGACGGCCTGGGAAGCACGATATACCTCGATGGAATCGTCACTCTGGTT
GACGCCAGAAATATCCTGCGCAGCCTGGAAGATGCGAGCGGCCAGGTGGACGAGCATGAGCTGCACGGCCACAAG
GGTCCGTTAATGACGACGGCGCACCTTCAGATCTCACATGCAGATGTCGTCGTCATCAATAAGGCAGATCTGGTC
AACGAAGAGGAGCTTCGTCTGGTAAGAGAACGCGTCGAATCTATCAATGGGCTCGCAAGGGTGCATGTGACAGAG
CGGAGCGTCGTCCCGCAGCTGGAAGGCTTTCTGTTGGACCTGCACGCCTATGACGAATTCAATGAAAGCGATTTC
GCAGCCAAGGGGCATAGCCACCTGGACCCGATACAGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGACTGCAG
CCGCATCAACTGGTCCTGGTTGATGCCTGGCTGCGAGAATTGCTCTGGGAGAACAGGGTTCCGGGCTCACACGAA
CAGGGGGACTTTGAGGTTCACCGTTCCAAGGGCCGTATTGTCCTTGAAAACGGGGAGGCTAGGATGCTTCAGGGC
GTCAGAGAGGTGTTTGAACTATCGGAGCCGCCAGACGGCGGGGAGGCACAGCCAGCTGATGGCAAGATGATCTTC
ATCGGAAGGCGGCTGGCAGAAGCGGGCTTGGCGGATAGTTTCAGAAGAGCTTTGCAGAATAGCTGA
Gene >Ophun1|1971
ATGGAGCCCGATGGAGACGCCCCTCCCGATTTGGTGGACACCGCGGAGGAGCTGCAAGCCGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGGTGCGTCGACGAGCTCCGAGATGGGAGTGGCAAGCGTTGCGGACATGGAGTGA
AAGCGTCTCAATCATTGGGCCAGGTTACCTCGGAGCCGGAAAGACAACTCTCTTGAATTATATCCTCACGGCCCG
GCATGGGAAAAAGATTGCTGTCATCATGAATGGTTGTTAATCGCTAGTCGCGACTCTTGTGCCCCTACTGACGCC
GATTAGAGTTTGGCGACTGTGAGTGACGATGACTGCATGTGACTGGGGGACAGACGTCTTAACACCAAAGCAGCC
CTGGATATTGAGAAGTCCTTGACTGTCAACAAAGGCGAAGAAAAGTTTGAGGAGTGGCTCGAAGTCGGAAATGGC
TGTATATGCTGTTCCGTCAAGTTCGTCCAGCCATGGTAATTGCCATCAATTCCCGCTGACGCCCTCCCAGAGACA
CCGGAGTCAATGCCATCGAGTCCCTTATGAGCAAGAAAGGCGCCTTTGACTACATTCTACTGGAGACTACCGGTC
TTGCCGATCCCGGAAACATTGCTCCTCTCTTCTGGGTGGATGACGGCCTGGGAAGCACGATATACCTCGATGGAA
TCGTCACTCTGGTTGACGCCAGAAATATCCTGCGCAGCCTGGAAGATGCGAGCGGCCAGGTGGACGAGCATGAGC
TGCACGGCCACAAGGGTCCGTTAATGACGACGGCGCACCTTCAGATCTCACATGCAGATGTCGTCGTCATCAATA
AGGCAGATCTGGTCAACGAAGAGGAGCTTCGTCTGGTAAGAGAACGCGTCGAATCTATCAATGGGCTCGCAAGGG
TGCATGTGACAGAGCGGAGCGTCGTCCCGCAGCTGGAAGGCTTTCTGTTGGACCTGCACGCCTATGACGAATTCA
ATGAAAGCGATTTCGCAGCCAAGGGGCATAGCCACCTGGACCCGGTAAGTGATGAGAGGCGGCGCTCGCTCAACA
AGGCGCCCATGGGACTGATAGATACAGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGACTGCAGCCGCATCAA
CTGGTCCTGGTTGATGCCTGGCTGCGAGAATTGCTCTGGGAGAACAGGGTTCCGGGCTCACACGAACAGGGGGAC
TTTGAGGTTCACCGTTCCAAGGGCCGTATTGTCCTTGAAAACGGGGAGGCTAGGATGCTTCAGGGCGTCAGAGAG
GTGTTTGAACTATCGGAGCCGCCAGACGGCGGGGAGGCACAGCCAGCTGATGGCAAGATGATCTTCATCGGAAGG
CGGCTGGCAGAAGCGGGCTTGGCGGATAGTTTCAGAAGAGCTTTGCAGAATAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail