Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1970
Gene name
LocationContig_19:39381..42228
Strand-
Gene length (bp)2847
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family 2.9E-29 286 397
PF08585 RMI1_N RecQ mediated genome instability protein 2.9E-25 533 618
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 3.4E-07 453 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87240|NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not2 PE=1 SV=2 249 398 3.0E-30
sp|Q9NZN8|CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens GN=CNOT2 PE=1 SV=1 231 408 7.0E-24
sp|Q8C5L3|CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus GN=Cnot2 PE=1 SV=2 231 410 9.0E-24
sp|Q52JK6|VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana GN=VIP2 PE=1 SV=1 221 393 2.0E-22
sp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana GN=VIP2 PE=1 SV=2 210 394 7.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87240|NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not2 PE=1 SV=2 249 398 3.0E-30
sp|Q9NZN8|CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens GN=CNOT2 PE=1 SV=1 231 408 7.0E-24
sp|Q8C5L3|CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus GN=Cnot2 PE=1 SV=2 231 410 9.0E-24
sp|Q52JK6|VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana GN=VIP2 PE=1 SV=1 221 393 2.0E-22
sp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana GN=VIP2 PE=1 SV=2 210 394 7.0E-20
sp|Q94547|RGA_DROME Regulator of gene activity OS=Drosophila melanogaster GN=Rga PE=1 SV=2 233 408 3.0E-19
sp|P06100|NOT2_YEAST General negative regulator of transcription subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC36 PE=1 SV=1 297 395 8.0E-18
sp|Q04052|ARO80_YEAST Transcriptional activator ARO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO80 PE=1 SV=1 447 494 3.0E-16
sp|Q8K0V4|CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1 313 398 3.0E-09
sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1 313 398 4.0E-09
sp|O13870|NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not3 PE=1 SV=2 318 398 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0043169 cation binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6056
Ophiocordyceps australis map64 (Brazil) OphauB2|2744
Ophiocordyceps camponoti-floridani Ophcf2|04024
Ophiocordyceps camponoti-rufipedis Ophun1|1970 (this protein)
Ophiocordyceps kimflemingae Ophio5|5847
Ophiocordyceps subramaniannii Hirsu2|3579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1970
MGASGFPNQAHQLGGNLSFAQSLTGSQPATPLDLSEFPSLANNSQLNTTGQPSLWSASGSRNPSGPVQRSQSIPV
TTQPSGQDDLFNPSSSRVPPNQAANGYLRSERSANMMSSLGFAPQSSSSAHVQANKGNGLLNALSANSRANEARS
PPGGASSRASDAKRPDDMRQKAPTFRDDGFGKTPAGDGAMQAAGARNQLGAIGNDGSQAKFKDDKASQHPEAVDP
LAGMAAVDKWGIKGLRTLMNNYPDFHAMVVGMDPSTLGLDLSTQELISPQIYSLFDEQPPRPTVTSSKFRLPDCY
SVTNVQPIESKIQSFNEETLFWLFYSCPADMKQQMAAVELHSRNWRWHKKLQIWLTKDEHMNPQILSPNHERGYY
IVWDANNWRKDRREFTLHYGDLDTTLNAAPTLNISRGAPWLVYSALTMILRIGNGSATATTTTTTATTATSQHKR
VYQACIPCRRRKVRCDLGSVDNPHDPPCVRCRRESKECFFSATRRKRKTDEAAEGGSDADDYMLRNGRKRLLASG
SPPPPPTTTTTTGEARAGATHRLVLQDCRGTRVFAVELRRVERVGVGSTAMGEKILLRAGTVVARGTVLLAPETC
LLLGGRVDAWHDVWAAGRLRRLEEAAAGD*
Coding >Ophun1|1970
ATGGGAGCTTCAGGTTTTCCCAACCAAGCACATCAGCTGGGTGGAAACCTTAGCTTCGCTCAGAGCTTGACGGGG
TCGCAACCTGCTACGCCGTTGGATCTATCAGAATTTCCCTCTCTGGCGAATAACTCGCAACTGAACACTACCGGG
CAGCCCTCGCTGTGGTCTGCCTCCGGTTCGCGAAATCCCAGCGGTCCCGTTCAGCGCAGCCAGTCCATCCCGGTC
ACTACCCAGCCATCAGGACAAGACGACCTGTTCAACCCTTCATCTTCTCGGGTGCCGCCCAACCAAGCTGCCAAC
GGCTATCTTCGATCGGAACGGAGCGCCAACATGATGTCGTCGCTAGGCTTCGCGCCTCAAAGCTCCAGCTCGGCA
CATGTGCAGGCGAACAAAGGCAACGGTCTGCTGAATGCCTTGTCTGCGAACAGCCGGGCCAATGAGGCGCGGTCG
CCGCCTGGAGGAGCTTCATCACGAGCATCGGATGCGAAGCGACCCGACGATATGAGGCAGAAGGCGCCCACGTTT
CGCGATGACGGCTTCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGGCCGGCGCAAGGAACCAGCTTGGC
GCCATCGGAAACGATGGCTCGCAGGCAAAGTTCAAGGACGACAAGGCGAGCCAACATCCGGAAGCTGTCGACCCT
CTGGCAGGCATGGCGGCCGTGGACAAGTGGGGGATTAAGGGTCTGCGAACTCTGATGAACAACTATCCCGACTTT
CATGCCATGGTGGTGGGAATGGACCCGAGCACGCTGGGGCTGGATCTGAGCACTCAAGAGCTCATTTCTCCGCAA
ATCTACTCCCTGTTCGACGAGCAACCGCCGAGACCGACGGTAACATCGAGTAAATTCCGCCTGCCCGACTGCTAC
AGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAACGAGGAGACGTTGTTCTGGCTCTTCTAC
AGCTGTCCAGCAGACATGAAGCAGCAAATGGCGGCGGTGGAGCTGCATTCTCGAAACTGGCGGTGGCACAAGAAG
CTACAGATTTGGCTCACCAAGGATGAGCACATGAACCCGCAAATCCTGAGCCCCAACCACGAGCGAGGCTACTAC
ATCGTATGGGACGCAAACAACTGGCGGAAAGACCGAAGAGAGTTTACGCTGCACTACGGGGACCTGGACACGACG
CTGAACGCGGCACCGACATTAAATATATCGCGCGGTGCTCCATGGCTGGTCTACTCGGCGTTGACCATGATACTT
CGTATTGGGAATGGGTCCGCGACAGCGACGACGACGACGACGACAGCGACGACAGCGACGTCACAGCACAAACGC
GTCTACCAAGCCTGCATCCCCTGCCGAAGACGAAAAGTGCGCTGCGACCTGGGAAGCGTCGACAACCCGCACGAC
CCCCCCTGCGTACGCTGCCGCCGCGAAAGCAAAGAATGTTTCTTCAGCGCGACGCGCCGCAAGCGCAAGACGGAC
GAGGCGGCCGAGGGCGGAAGCGACGCCGACGATTACATGCTGCGCAACGGGCGGAAGCGGCTGCTGGCTTCGGGG
AGTCCGCCGCCGCCGCCGACGACGACGACGACGACGGGGGAGGCGAGGGCGGGGGCCACGCATCGGCTTGTGCTG
CAGGATTGTCGGGGGACGCGCGTTTTCGCGGTTGAGCTGAGGCGCGTGGAGAGGGTTGGGGTGGGGAGTACGGCT
ATGGGGGAGAAGATTCTGCTTCGGGCTGGGACGGTGGTGGCGAGGGGGACGGTTTTGCTGGCGCCGGAGACGTGT
TTGTTGCTTGGGGGGAGGGTTGATGCCTGGCATGATGTTTGGGCGGCTGGGAGGTTGCGGAGGTTGGAAGAGGCT
GCGGCTGGGGACTGA
Transcript >Ophun1|1970
ATGGGAGCTTCAGGTTTTCCCAACCAAGCACATCAGCTGGGTGGAAACCTTAGCTTCGCTCAGAGCTTGACGGGG
TCGCAACCTGCTACGCCGTTGGATCTATCAGAATTTCCCTCTCTGGCGAATAACTCGCAACTGAACACTACCGGG
CAGCCCTCGCTGTGGTCTGCCTCCGGTTCGCGAAATCCCAGCGGTCCCGTTCAGCGCAGCCAGTCCATCCCGGTC
ACTACCCAGCCATCAGGACAAGACGACCTGTTCAACCCTTCATCTTCTCGGGTGCCGCCCAACCAAGCTGCCAAC
GGCTATCTTCGATCGGAACGGAGCGCCAACATGATGTCGTCGCTAGGCTTCGCGCCTCAAAGCTCCAGCTCGGCA
CATGTGCAGGCGAACAAAGGCAACGGTCTGCTGAATGCCTTGTCTGCGAACAGCCGGGCCAATGAGGCGCGGTCG
CCGCCTGGAGGAGCTTCATCACGAGCATCGGATGCGAAGCGACCCGACGATATGAGGCAGAAGGCGCCCACGTTT
CGCGATGACGGCTTCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGGCCGGCGCAAGGAACCAGCTTGGC
GCCATCGGAAACGATGGCTCGCAGGCAAAGTTCAAGGACGACAAGGCGAGCCAACATCCGGAAGCTGTCGACCCT
CTGGCAGGCATGGCGGCCGTGGACAAGTGGGGGATTAAGGGTCTGCGAACTCTGATGAACAACTATCCCGACTTT
CATGCCATGGTGGTGGGAATGGACCCGAGCACGCTGGGGCTGGATCTGAGCACTCAAGAGCTCATTTCTCCGCAA
ATCTACTCCCTGTTCGACGAGCAACCGCCGAGACCGACGGTAACATCGAGTAAATTCCGCCTGCCCGACTGCTAC
AGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAACGAGGAGACGTTGTTCTGGCTCTTCTAC
AGCTGTCCAGCAGACATGAAGCAGCAAATGGCGGCGGTGGAGCTGCATTCTCGAAACTGGCGGTGGCACAAGAAG
CTACAGATTTGGCTCACCAAGGATGAGCACATGAACCCGCAAATCCTGAGCCCCAACCACGAGCGAGGCTACTAC
ATCGTATGGGACGCAAACAACTGGCGGAAAGACCGAAGAGAGTTTACGCTGCACTACGGGGACCTGGACACGACG
CTGAACGCGGCACCGACATTAAATATATCGCGCGGTGCTCCATGGCTGGTCTACTCGGCGTTGACCATGATACTT
CGTATTGGGAATGGGTCCGCGACAGCGACGACGACGACGACGACAGCGACGACAGCGACGTCACAGCACAAACGC
GTCTACCAAGCCTGCATCCCCTGCCGAAGACGAAAAGTGCGCTGCGACCTGGGAAGCGTCGACAACCCGCACGAC
CCCCCCTGCGTACGCTGCCGCCGCGAAAGCAAAGAATGTTTCTTCAGCGCGACGCGCCGCAAGCGCAAGACGGAC
GAGGCGGCCGAGGGCGGAAGCGACGCCGACGATTACATGCTGCGCAACGGGCGGAAGCGGCTGCTGGCTTCGGGG
AGTCCGCCGCCGCCGCCGACGACGACGACGACGACGGGGGAGGCGAGGGCGGGGGCCACGCATCGGCTTGTGCTG
CAGGATTGTCGGGGGACGCGCGTTTTCGCGGTTGAGCTGAGGCGCGTGGAGAGGGTTGGGGTGGGGAGTACGGCT
ATGGGGGAGAAGATTCTGCTTCGGGCTGGGACGGTGGTGGCGAGGGGGACGGTTTTGCTGGCGCCGGAGACGTGT
TTGTTGCTTGGGGGGAGGGTTGATGCCTGGCATGATGTTTGGGCGGCTGGGAGGTTGCGGAGGTTGGAAGAGGCT
GCGGCTGGGGACTGA
Gene >Ophun1|1970
ATGGGAGCTTCAGGTTTTCCCAACCAAGCACATCAGCTGGGTGGAAACCTTAGCTTCGCTCAGAGCTTGACGGGG
TCGCAACCTGCTACGCCGTTGGATCTATCGTACGTATCTAAGCTTTCTCTTCCCTTATCTATCAGCCTGCCTATC
TGCTTTTCGTCGATTTCCCTCTGCCTGCCTGTATGAATCATGCTGTGGCAGCAAGTCTTGGCAAACAGGCCAGGT
GCCAGCGAACTTGGTCGCTACTCCTAACCCGTTGGGGGCACACGGTTTCTGTTTCCTCGTCCCCATTCCACTCAC
CTTGCCCACCTTTCTTTGACTGCATCACAACTCTGGCAAGCAAGCGCATTAACTATATCTCTAGAGAATTTCCCT
CTCTGGCGAATAACTCGCAACTGAACACTACCGGGCAGCCCTCGCTGTGGTCTGCCTCCGGTTCGCGAAATCCCA
GCGGTCCCGTTCAGCGCAGCCAGTCCATCCCGGTCACTACCCAGCCATCAGGACAAGACGACCTGTTCAACCCTT
CATCTTCTCGGGTGCCGCCCAACCAAGGTTCGTTACAAAGCTTTCCCGCCGTCTCTCGGGATCCGTCGGGCAACG
TTGACGTCCCGACCGCAGCTGCCAACGGCTATCTTCGATCGGAACGGAGCGCCAACATGATGTCGTCGCTAGGCT
TCGCGCCTCAAAGCTCCAGCTCGGCACATGTGCAGGCGAACAAAGGCAACGGTCTGCTGAATGCCTTGTCTGCGA
ACAGCCGGGCCAATGAGGCGCGGTCGCCGCCTGGAGGAGGTGCATCAGGTAGGTCTACCCCTCTTTGATGGTGTG
TCTCACCGTGTGTTGACCTCGGCCAGCTTCATCACGAGCATCGGATGCGAAGCGACCCGACGATATGAGGCAGAA
GGCGCCCACGTTTCGCGATGACGGCTTCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGGCCGGCGCAAG
GAACCAGCTTGGCGCCATCGGAAACGATGGCTCGCAGGCAAAGTTCAAGGACGACAAGGCGAGCCAACATCCGGA
AGCTGTCGACCCTCTGGCAGGCATGGCGGCCGTGGACAAGTGGGGGATTAAGGGTCTGCGAACTCTGATGAACAA
CTATCCCGACTTTCATGCCATGGTGGTGGGAATGGACCCGAGCACGCTGGGGCTGGATCTGAGCACTCAAGAGTC
AGTCCATCTGGGGCGCAAATGGCGAGTTTTCGACTTTGGCTGACGTAGCAGAAGGCTCATTTCTCCGCAAATCTA
CTCCCTGTTCGACGAGCAACCGCCGAGACCGACGGTAACATCGAGTAAATTCCGCCTGCCCGACTGCTACAGCGT
CACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAACGAGGAGACGTTGTTCTGGCTCTTCTACAGCTG
TCCAGCAGACATGAAGCAGCAAATGGCGGCGGTGGAGCTGTAAGAGAACCCCGTTCCCGTCGAAGCCGGCTCTAA
CGGTTCAACAGGCATTCTCGAAACTGGCGGTGGCACAAGAAGCTACAGATTTGGCTCACCAAGGATGAGCACATG
AACCCGCAAATCCTGAGCCCCAACCACGAGCGAGGCTACTACATCGTATGGGACGCAAACAACTGGCGGAAAGAC
CGAGTAAGTGAACTGCGACCCCCTTCGTGGCCCGGACAAGTGCTGACCGAGAGGCTCAGAGAGAGTTTACGCTGC
ACTACGGGGACCTGGACACGACGCTGAACGCGGCACCGACATTAAATATATCGTAGCTGCTACCGGTTAATGCTC
CCCTTGGTTTATGATACGGGTCGTTGCGCGATGCCAGGCGCGGTGCTCCATGGCTGGTCTACTCGGCGTTGACCA
TGATACTTCGTATTGGGAATGGGTCCGGTGGCCAGAGAGCCTTGGAATGCATTTTCGGGGAGATATACGGTAGAC
CTACGGCCGTGTAAAGCATGGCGCCTCAAGTTGACGAGCGCATCACTGTTCATCGTGGTCCATTTTCTTGTGATG
TGTTTGTAGTCTATACGAAGACGACGAAGACGACGAAGACGACGAAGAAGACGAAGACGACGAAGAAGACGAAGA
AGACGAAGAAGACGAAGAACGAGGTCGAACTCATGCCCCTTTGTCTTGGAGATGGCGAGGCCGTTGTTGGGGTCG
AGCCCTGAGGGGGTGGTGGCGACGACGCCTGGGGGAGGAGGGGAGACGGTGGAGGGATCGACAGCGACAGCGACA
GCGACAGCGACGACGACGACGACGACAGCGACGACAGCGACGTCACAGCACAAACGCGTCTACCAAGCCTGCATC
CCCTGCCGAAGACGAAAAGTGCGCTGCGACCTGGGAAGCGTCGACAACCCGCACGACCCCCCCTGCGTACGCTGC
CGCCGCGAAAGCAAAGAATGTTTCTTCAGCGCGACGCGCCGCAAGCGCAAGACGGACGAGGCGGCCGAGGGCGGA
AGCGACGCCGACGATTACATGCTGCGCAACGGGCGGAAGCGGCTGCTGGCTTCGGGGAGTCCGCCGCCGCCGCCG
ACGACGACGACGACGACGGGGGAGGCGAGGGCGGGGGCCACGCATCGGCTTGTGCTGCAGGATTGTCGGGGGACG
CGCGTTTTCGCGGTTGAGCTGAGGCGCGTGGAGAGGGTTGGGGTGGGGAGTACGGCTATGGGGGAGAAGATTCTG
CTTCGGGCTGGGACGGTGGTGGCGAGGGGGACGGTTTTGCTGGCGCCGGAGACGTGTTTGTTGCTTGGGGGGAGG
GTTGATGCCTGGCATGATGTTTGGGCGGCTGGGAGGTTGCGGAGGTTGGAAGAGGCTGCGGCTGGGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail