Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1969
Gene name
LocationContig_19:34948..39286
Strand+
Gene length (bp)4338
Transcript length (bp)4275
Coding sequence length (bp)4275
Protein length (aa) 1425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18833 TPR_22 Tetratricopeptide repeat 5.2E-27 142 229
PF13432 TPR_16 Tetratricopeptide repeat 8.1E-06 12 72
PF13432 TPR_16 Tetratricopeptide repeat 1.4E-02 431 487
PF13432 TPR_16 Tetratricopeptide repeat 3.3E-03 660 709
PF13432 TPR_16 Tetratricopeptide repeat 3.1E-05 994 1052
PF13432 TPR_16 Tetratricopeptide repeat 1.9E-03 1205 1246
PF13181 TPR_8 Tetratricopeptide repeat 1.2E-01 734 762

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94474|SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski3 PE=3 SV=1 4 1421 3.0E-179
sp|P17883|SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI3 PE=1 SV=2 1 1417 7.0E-123
sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 OS=Xenopus laevis GN=ttc37 PE=2 SV=1 579 1356 7.0E-41
sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 OS=Homo sapiens GN=TTC37 PE=1 SV=1 460 1051 5.0E-37
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 536 816 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94474|SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski3 PE=3 SV=1 4 1421 3.0E-179
sp|P17883|SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI3 PE=1 SV=2 1 1417 7.0E-123
sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 OS=Xenopus laevis GN=ttc37 PE=2 SV=1 579 1356 7.0E-41
sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 OS=Homo sapiens GN=TTC37 PE=1 SV=1 460 1051 5.0E-37
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 536 816 3.0E-11
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 950 1029 2.0E-07
sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 OS=Homo sapiens GN=TTC37 PE=1 SV=1 5 134 4.0E-06
sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 OS=Xenopus laevis GN=ttc37 PE=2 SV=1 5 115 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2893
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6415
Ophiocordyceps australis map64 (Brazil) OphauB2|3346
Ophiocordyceps camponoti-floridani Ophcf2|03163
Ophiocordyceps camponoti-rufipedis Ophun1|1969 (this protein)
Ophiocordyceps kimflemingae Ophio5|5671
Ophiocordyceps subramaniannii Hirsu2|4820

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1969
MSRSKAMLKGINDAIRQNKFDDAVKAARELLSKDAKNYQGRVFLAFALDNKNESIEAETVYLEAIESRPQDPQAY
QGLVKVYEKMGTRKLADYQRIVISLARILADAGETYKSQDVVDKFIDFARSQGSPLQYADALCIRLPESPLYSVL
EGRFPRPAETYETITRIVEDAEKRRINTLIGERRTRLGATLVDVTLQVKREVYGQSRLEHLYRQLINWTSDDNVR
RMYEEKLLQYCHDRLLVLPSAVKLEQQSVVIGLARDMVIIKHPFKLAWDIAVNWQDNKEISDWDVDLLRNYCSFF
PESDLYKVITAYLTSSFSPFPELKKPDNQNASTAPSDDSEDDDDGGGAPTAWVPLTEEDRLVMITEGMSMSESTF
AYRLAGHYFLQLGEYETTVDFMRKAQQYVTKERASTGLPFRDTQDAYSLYLATALVYYQSPRHHQEAKALFDGVL
EHDETRTSALIGVGLIFEEEQDYDEAIDFLSRALERDGSNLRVRSEAAWVKALKGDWQTAKDELMCCIEPLESQG
VIAKELLADTQYRVGCCIWNLETGRQARKQKKGECAYAYWLTALGNNMKHAPCYTSLGVFYRDYAKDRNRARRCF
QKALELSSAEVVSAQSLAQSFAEDADWERVELVARRVVDSGVVRPPPGSKRKGISWPFSALGVAELNKRDFHKAI
VSFQSALKLSPDDYHSWVGLGESYHSSGRFMAATKAILNAQELETDGRDVSADTWFTKYMLANIKRELGEYDESM
ILYRSVLETRPAEEGVILALMQTMTENALSSVENGLFGKAVQLAIDTVHVAADTGPKVRGTFNFWKSLAEACSVF
TLVHSRAADFPTQALRGLLEASDQDAYDFLANIDKIGTDVVYAKGIYAEDEQPGVDRTRCVHATILCHKQAIHIS
SSDQHAQAVAHYNLGWAEYRAHVCLPLDVRRKPSSYLRASVRALKRSIELESGNAEFWNALGVATSEINPAVSQH
ALVRSLHLNERSPATWTNLGTLALLSKDLKLANEALTRAQSTDPDYAHAWLGQAFIALLVGDADEARSLFTHALD
IAESCSLPSRQHYAAAVFDRVLSSGASDSSVVSLIQPLFALGQVQSLRPQDLVFTHMATLFLERTRESPRAMRTL
KDMCGAIEADYETTESADSLVRFTLAKADLARAYLADGSYEEAVECGETALGLSGEEGEGELTGEQRKRVRLSAQ
LTTGLGHFFLGAFDEAEKCFEAALEESGGDPDAACLLAQVLWAQGSEASRQRARNTLLDVVETRPDHVQSVLLLG
TVALVDNDEAGLEAVTEALQGLRASDGVTTTEQSQACDVLGAIAMKSAGDDGSSQEDEMLAQLQTDMMLRPHLPD
GWGSLAEATGDGHAAAMALRVAVRGIPPRGALEAEQLARAYAGTGLAADAQRAMMVAPWAAVGREALKAATEGV*
Coding >Ophun1|1969
ATGTCGCGCTCCAAGGCCATGCTGAAGGGCATTAACGATGCTATTCGGCAAAACAAGTTCGATGACGCTGTCAAA
GCGGCGAGGGAGCTTCTGAGCAAAGATGCGAAAAACTACCAAGGTCGCGTCTTCCTCGCCTTTGCCCTCGACAAC
AAGAACGAGTCGATAGAAGCCGAGACAGTATATCTCGAGGCAATAGAGTCACGCCCTCAAGACCCGCAAGCGTAC
CAGGGACTTGTCAAGGTCTACGAGAAGATGGGCACCAGGAAGCTCGCCGATTATCAACGCATCGTCATCAGCCTG
GCCCGCATCCTTGCCGACGCGGGCGAGACGTACAAGTCCCAAGACGTTGTTGACAAGTTCATCGACTTTGCCAGA
AGCCAGGGCAGTCCTCTACAGTATGCCGATGCCTTGTGCATTAGACTCCCGGAGAGCCCCCTCTATTCCGTCTTG
GAGGGCCGCTTTCCCCGGCCGGCAGAGACGTACGAGACCATTACGCGCATAGTGGAAGATGCCGAGAAGAGGCGG
ATCAACACGCTTATTGGCGAGCGTCGCACTCGACTGGGCGCCACTCTTGTCGACGTAACTCTCCAGGTCAAGCGT
GAGGTCTACGGCCAGAGCAGACTAGAGCACCTCTACCGTCAGCTCATCAACTGGACGTCGGACGACAACGTGCGG
CGTATGTACGAAGAGAAGTTGCTTCAGTACTGCCACGACCGCCTCTTGGTTCTTCCGTCCGCCGTCAAGCTCGAG
CAGCAGAGCGTCGTCATCGGCCTTGCGAGGGACATGGTCATCATCAAGCACCCCTTCAAGCTTGCATGGGACATT
GCCGTCAACTGGCAAGACAACAAGGAGATTTCAGACTGGGACGTCGATCTACTACGAAATTACTGCTCATTTTTC
CCTGAATCCGATCTCTACAAGGTCATCACGGCCTATCTAACGAGCAGCTTCTCGCCCTTTCCCGAACTCAAGAAG
CCGGATAACCAAAACGCCTCGACTGCCCCGTCTGATGACAGTGAAGATGACGACGACGGCGGCGGCGCTCCCACC
GCCTGGGTGCCGTTGACGGAGGAGGACCGGCTGGTCATGATCACCGAGGGTATGAGCATGAGCGAATCGACTTTC
GCGTATCGTCTCGCTGGCCATTACTTTTTGCAGTTGGGCGAGTACGAGACCACTGTCGACTTTATGCGCAAAGCT
CAGCAGTACGTGACCAAGGAACGTGCCTCAACGGGGCTCCCCTTTCGAGACACGCAAGACGCGTATTCGCTGTAT
CTCGCCACTGCTTTGGTCTACTACCAATCCCCACGACATCATCAGGAAGCCAAGGCGTTGTTTGATGGCGTTCTC
GAACATGACGAGACACGAACTTCGGCGCTGATTGGCGTCGGGCTAATATTCGAGGAGGAGCAAGACTATGACGAG
GCCATCGACTTTCTCAGCCGCGCTCTTGAGAGGGACGGATCCAACCTGCGCGTCAGATCAGAAGCTGCCTGGGTC
AAGGCTCTCAAAGGCGACTGGCAGACGGCCAAGGATGAGCTAATGTGCTGTATCGAACCCCTGGAATCGCAAGGA
GTCATCGCTAAAGAGCTGCTGGCGGACACTCAGTACCGCGTCGGCTGCTGCATCTGGAACCTCGAAACGGGCCGC
CAGGCGAGAAAACAGAAGAAGGGAGAATGCGCCTATGCCTACTGGCTGACGGCTCTCGGGAACAACATGAAGCAC
GCCCCCTGTTACACGAGCCTCGGCGTCTTCTATCGTGACTACGCCAAAGACCGGAACCGAGCCCGGCGCTGCTTT
CAAAAGGCCCTCGAGCTCTCGTCGGCCGAGGTGGTTTCCGCCCAGAGTCTGGCCCAGTCGTTCGCCGAAGACGCC
GACTGGGAGCGCGTCGAGCTCGTGGCGCGGAGAGTCGTCGATTCGGGCGTGGTGAGGCCGCCGCCGGGATCCAAG
CGAAAGGGCATCAGCTGGCCCTTCTCGGCGTTGGGCGTCGCCGAGCTGAACAAGCGAGACTTTCACAAGGCCATC
GTCTCGTTCCAGTCGGCCCTGAAGCTATCGCCGGACGACTATCACTCGTGGGTCGGGCTGGGCGAGAGCTACCAC
AGCTCCGGTCGGTTCATGGCGGCTACCAAGGCCATCCTCAACGCCCAGGAGCTCGAGACAGATGGAAGAGACGTC
TCTGCCGATACTTGGTTCACCAAGTACATGCTTGCCAACATCAAGCGCGAGCTGGGCGAGTACGACGAATCCATG
ATCCTGTACCGGTCCGTGCTGGAGACGCGGCCGGCAGAGGAGGGCGTGATCCTAGCCCTCATGCAGACGATGACG
GAGAATGCGCTGTCGAGCGTGGAAAATGGTCTATTTGGCAAGGCTGTACAGCTGGCCATCGACACCGTCCACGTC
GCCGCAGATACGGGGCCCAAGGTCAGGGGCACTTTCAACTTTTGGAAGAGTCTCGCCGAAGCCTGCTCCGTCTTT
ACGTTGGTTCACAGCCGGGCTGCGGATTTTCCCACTCAGGCTCTCAGGGGCCTGCTGGAAGCAAGCGATCAAGAC
GCGTACGACTTCCTCGCCAACATCGATAAGATCGGGACCGACGTCGTCTACGCCAAGGGCATCTATGCCGAGGAC
GAGCAGCCGGGCGTGGACCGGACGAGATGTGTCCACGCAACCATTCTCTGTCACAAGCAAGCCATCCACATCTCG
TCGAGCGACCAGCACGCCCAGGCCGTGGCTCACTACAACCTGGGCTGGGCAGAGTACCGGGCTCACGTCTGCCTG
CCCCTTGACGTGCGTCGCAAGCCAAGCAGCTATCTCCGGGCCTCGGTGCGAGCCCTGAAGCGATCCATCGAGCTG
GAGAGCGGCAACGCCGAGTTCTGGAACGCCCTGGGCGTCGCAACCAGTGAGATCAACCCGGCCGTCTCGCAGCAC
GCCCTCGTCAGGAGCCTGCACCTCAACGAGCGAAGCCCCGCGACGTGGACCAATCTAGGGACGCTGGCGCTGCTA
TCGAAGGATCTGAAGCTGGCCAACGAGGCCTTAACCCGGGCGCAGTCGACGGATCCGGACTATGCGCACGCTTGG
TTGGGGCAGGCCTTCATCGCGTTGCTCGTGGGAGACGCCGACGAGGCTCGGAGCCTGTTCACGCACGCGCTGGAC
ATTGCCGAGTCTTGCTCCCTGCCGAGCCGACAGCACTATGCGGCGGCCGTCTTTGACCGCGTCTTATCATCCGGA
GCTTCAGACTCGTCGGTCGTATCATTGATCCAGCCGCTGTTTGCGCTCGGCCAGGTTCAGAGCCTGAGGCCGCAG
GATCTCGTCTTCACCCACATGGCCACTCTCTTCCTGGAGCGGACACGGGAAAGTCCCCGCGCGATGCGCACCCTC
AAGGACATGTGCGGCGCCATCGAAGCTGACTACGAGACGACGGAGTCGGCCGATAGCCTGGTCAGGTTCACGCTC
GCCAAGGCAGATCTGGCTCGGGCCTACCTGGCCGACGGTTCGTACGAGGAAGCTGTCGAGTGCGGCGAGACGGCG
CTCGGGCTCAGCGGAGAGGAGGGCGAGGGCGAGCTGACGGGCGAGCAGAGGAAGAGGGTCAGGCTCTCGGCGCAG
CTGACGACGGGACTGGGGCACTTCTTCCTCGGCGCCTTTGACGAGGCCGAGAAGTGCTTCGAGGCCGCGCTTGAA
GAATCGGGCGGCGACCCAGACGCGGCCTGTCTCCTGGCGCAGGTTCTCTGGGCGCAAGGATCTGAAGCGTCGCGA
CAGAGGGCTCGGAACACGCTTCTGGATGTGGTCGAGACGAGACCAGACCACGTGCAGAGCGTGCTGCTGCTAGGC
ACCGTGGCTCTTGTCGACAACGACGAGGCCGGACTAGAAGCCGTGACCGAAGCGCTGCAGGGGCTGCGAGCCAGC
GACGGCGTCACGACGACGGAGCAGAGCCAAGCATGCGACGTGCTGGGCGCCATAGCCATGAAGAGCGCTGGCGAC
GACGGCAGCTCACAGGAAGACGAGATGCTTGCCCAGCTGCAGACCGACATGATGCTGCGTCCACATCTGCCCGAC
GGCTGGGGCTCGCTGGCCGAAGCGACGGGCGACGGACACGCGGCGGCCATGGCGCTCCGCGTCGCTGTCCGCGGT
ATCCCTCCGAGGGGCGCCCTGGAGGCGGAACAGCTGGCGAGGGCGTATGCGGGCACTGGTCTGGCGGCAGACGCG
CAACGGGCCATGATGGTTGCGCCGTGGGCTGCGGTCGGGAGGGAGGCGTTGAAGGCGGCGACGGAGGGCGTGTAG
Transcript >Ophun1|1969
ATGTCGCGCTCCAAGGCCATGCTGAAGGGCATTAACGATGCTATTCGGCAAAACAAGTTCGATGACGCTGTCAAA
GCGGCGAGGGAGCTTCTGAGCAAAGATGCGAAAAACTACCAAGGTCGCGTCTTCCTCGCCTTTGCCCTCGACAAC
AAGAACGAGTCGATAGAAGCCGAGACAGTATATCTCGAGGCAATAGAGTCACGCCCTCAAGACCCGCAAGCGTAC
CAGGGACTTGTCAAGGTCTACGAGAAGATGGGCACCAGGAAGCTCGCCGATTATCAACGCATCGTCATCAGCCTG
GCCCGCATCCTTGCCGACGCGGGCGAGACGTACAAGTCCCAAGACGTTGTTGACAAGTTCATCGACTTTGCCAGA
AGCCAGGGCAGTCCTCTACAGTATGCCGATGCCTTGTGCATTAGACTCCCGGAGAGCCCCCTCTATTCCGTCTTG
GAGGGCCGCTTTCCCCGGCCGGCAGAGACGTACGAGACCATTACGCGCATAGTGGAAGATGCCGAGAAGAGGCGG
ATCAACACGCTTATTGGCGAGCGTCGCACTCGACTGGGCGCCACTCTTGTCGACGTAACTCTCCAGGTCAAGCGT
GAGGTCTACGGCCAGAGCAGACTAGAGCACCTCTACCGTCAGCTCATCAACTGGACGTCGGACGACAACGTGCGG
CGTATGTACGAAGAGAAGTTGCTTCAGTACTGCCACGACCGCCTCTTGGTTCTTCCGTCCGCCGTCAAGCTCGAG
CAGCAGAGCGTCGTCATCGGCCTTGCGAGGGACATGGTCATCATCAAGCACCCCTTCAAGCTTGCATGGGACATT
GCCGTCAACTGGCAAGACAACAAGGAGATTTCAGACTGGGACGTCGATCTACTACGAAATTACTGCTCATTTTTC
CCTGAATCCGATCTCTACAAGGTCATCACGGCCTATCTAACGAGCAGCTTCTCGCCCTTTCCCGAACTCAAGAAG
CCGGATAACCAAAACGCCTCGACTGCCCCGTCTGATGACAGTGAAGATGACGACGACGGCGGCGGCGCTCCCACC
GCCTGGGTGCCGTTGACGGAGGAGGACCGGCTGGTCATGATCACCGAGGGTATGAGCATGAGCGAATCGACTTTC
GCGTATCGTCTCGCTGGCCATTACTTTTTGCAGTTGGGCGAGTACGAGACCACTGTCGACTTTATGCGCAAAGCT
CAGCAGTACGTGACCAAGGAACGTGCCTCAACGGGGCTCCCCTTTCGAGACACGCAAGACGCGTATTCGCTGTAT
CTCGCCACTGCTTTGGTCTACTACCAATCCCCACGACATCATCAGGAAGCCAAGGCGTTGTTTGATGGCGTTCTC
GAACATGACGAGACACGAACTTCGGCGCTGATTGGCGTCGGGCTAATATTCGAGGAGGAGCAAGACTATGACGAG
GCCATCGACTTTCTCAGCCGCGCTCTTGAGAGGGACGGATCCAACCTGCGCGTCAGATCAGAAGCTGCCTGGGTC
AAGGCTCTCAAAGGCGACTGGCAGACGGCCAAGGATGAGCTAATGTGCTGTATCGAACCCCTGGAATCGCAAGGA
GTCATCGCTAAAGAGCTGCTGGCGGACACTCAGTACCGCGTCGGCTGCTGCATCTGGAACCTCGAAACGGGCCGC
CAGGCGAGAAAACAGAAGAAGGGAGAATGCGCCTATGCCTACTGGCTGACGGCTCTCGGGAACAACATGAAGCAC
GCCCCCTGTTACACGAGCCTCGGCGTCTTCTATCGTGACTACGCCAAAGACCGGAACCGAGCCCGGCGCTGCTTT
CAAAAGGCCCTCGAGCTCTCGTCGGCCGAGGTGGTTTCCGCCCAGAGTCTGGCCCAGTCGTTCGCCGAAGACGCC
GACTGGGAGCGCGTCGAGCTCGTGGCGCGGAGAGTCGTCGATTCGGGCGTGGTGAGGCCGCCGCCGGGATCCAAG
CGAAAGGGCATCAGCTGGCCCTTCTCGGCGTTGGGCGTCGCCGAGCTGAACAAGCGAGACTTTCACAAGGCCATC
GTCTCGTTCCAGTCGGCCCTGAAGCTATCGCCGGACGACTATCACTCGTGGGTCGGGCTGGGCGAGAGCTACCAC
AGCTCCGGTCGGTTCATGGCGGCTACCAAGGCCATCCTCAACGCCCAGGAGCTCGAGACAGATGGAAGAGACGTC
TCTGCCGATACTTGGTTCACCAAGTACATGCTTGCCAACATCAAGCGCGAGCTGGGCGAGTACGACGAATCCATG
ATCCTGTACCGGTCCGTGCTGGAGACGCGGCCGGCAGAGGAGGGCGTGATCCTAGCCCTCATGCAGACGATGACG
GAGAATGCGCTGTCGAGCGTGGAAAATGGTCTATTTGGCAAGGCTGTACAGCTGGCCATCGACACCGTCCACGTC
GCCGCAGATACGGGGCCCAAGGTCAGGGGCACTTTCAACTTTTGGAAGAGTCTCGCCGAAGCCTGCTCCGTCTTT
ACGTTGGTTCACAGCCGGGCTGCGGATTTTCCCACTCAGGCTCTCAGGGGCCTGCTGGAAGCAAGCGATCAAGAC
GCGTACGACTTCCTCGCCAACATCGATAAGATCGGGACCGACGTCGTCTACGCCAAGGGCATCTATGCCGAGGAC
GAGCAGCCGGGCGTGGACCGGACGAGATGTGTCCACGCAACCATTCTCTGTCACAAGCAAGCCATCCACATCTCG
TCGAGCGACCAGCACGCCCAGGCCGTGGCTCACTACAACCTGGGCTGGGCAGAGTACCGGGCTCACGTCTGCCTG
CCCCTTGACGTGCGTCGCAAGCCAAGCAGCTATCTCCGGGCCTCGGTGCGAGCCCTGAAGCGATCCATCGAGCTG
GAGAGCGGCAACGCCGAGTTCTGGAACGCCCTGGGCGTCGCAACCAGTGAGATCAACCCGGCCGTCTCGCAGCAC
GCCCTCGTCAGGAGCCTGCACCTCAACGAGCGAAGCCCCGCGACGTGGACCAATCTAGGGACGCTGGCGCTGCTA
TCGAAGGATCTGAAGCTGGCCAACGAGGCCTTAACCCGGGCGCAGTCGACGGATCCGGACTATGCGCACGCTTGG
TTGGGGCAGGCCTTCATCGCGTTGCTCGTGGGAGACGCCGACGAGGCTCGGAGCCTGTTCACGCACGCGCTGGAC
ATTGCCGAGTCTTGCTCCCTGCCGAGCCGACAGCACTATGCGGCGGCCGTCTTTGACCGCGTCTTATCATCCGGA
GCTTCAGACTCGTCGGTCGTATCATTGATCCAGCCGCTGTTTGCGCTCGGCCAGGTTCAGAGCCTGAGGCCGCAG
GATCTCGTCTTCACCCACATGGCCACTCTCTTCCTGGAGCGGACACGGGAAAGTCCCCGCGCGATGCGCACCCTC
AAGGACATGTGCGGCGCCATCGAAGCTGACTACGAGACGACGGAGTCGGCCGATAGCCTGGTCAGGTTCACGCTC
GCCAAGGCAGATCTGGCTCGGGCCTACCTGGCCGACGGTTCGTACGAGGAAGCTGTCGAGTGCGGCGAGACGGCG
CTCGGGCTCAGCGGAGAGGAGGGCGAGGGCGAGCTGACGGGCGAGCAGAGGAAGAGGGTCAGGCTCTCGGCGCAG
CTGACGACGGGACTGGGGCACTTCTTCCTCGGCGCCTTTGACGAGGCCGAGAAGTGCTTCGAGGCCGCGCTTGAA
GAATCGGGCGGCGACCCAGACGCGGCCTGTCTCCTGGCGCAGGTTCTCTGGGCGCAAGGATCTGAAGCGTCGCGA
CAGAGGGCTCGGAACACGCTTCTGGATGTGGTCGAGACGAGACCAGACCACGTGCAGAGCGTGCTGCTGCTAGGC
ACCGTGGCTCTTGTCGACAACGACGAGGCCGGACTAGAAGCCGTGACCGAAGCGCTGCAGGGGCTGCGAGCCAGC
GACGGCGTCACGACGACGGAGCAGAGCCAAGCATGCGACGTGCTGGGCGCCATAGCCATGAAGAGCGCTGGCGAC
GACGGCAGCTCACAGGAAGACGAGATGCTTGCCCAGCTGCAGACCGACATGATGCTGCGTCCACATCTGCCCGAC
GGCTGGGGCTCGCTGGCCGAAGCGACGGGCGACGGACACGCGGCGGCCATGGCGCTCCGCGTCGCTGTCCGCGGT
ATCCCTCCGAGGGGCGCCCTGGAGGCGGAACAGCTGGCGAGGGCGTATGCGGGCACTGGTCTGGCGGCAGACGCG
CAACGGGCCATGATGGTTGCGCCGTGGGCTGCGGTCGGGAGGGAGGCGTTGAAGGCGGCGACGGAGGGCGTGTAG
Gene >Ophun1|1969
ATGTCGCGCTCCAAGGCCATGCTGAAGGGCATTAACGATGCTATTCGGCAAAACAAGTTCGATGACGCTGTCAAA
GCGGCGAGGGAGCTTCTGAGCAAAGATGCGAAAAACTACCAAGGGTGTGTGAATTCTTTGATTCTCCCATTCGTC
ACTTCTCGAGAACCCTCAGCTAATCTGGTCAGTCGCGTCTTCCTCGCCTTTGCCCTCGACAACAAGAACGAGTCG
ATAGAAGCCGAGACAGTATATCTCGAGGCAATAGAGTCACGCCCTCAAGACCCGCAAGCGTACCAGGGACTTGTC
AAGGTCTACGAGAAGATGGGCACCAGGAAGCTCGCCGATTATCAACGCATCGTCATCAGCCTGGCCCGCATCCTT
GCCGACGCGGGCGAGACGTACAAGTCCCAAGACGTTGTTGACAAGTTCATCGACTTTGCCAGAAGCCAGGGCAGT
CCTCTACAGTATGCCGATGCCTTGTGCATTAGACTCCCGGAGAGCCCCCTCTATTCCGTCTTGGAGGGCCGCTTT
CCCCGGCCGGCAGAGACGTACGAGACCATTACGCGCATAGTGGAAGATGCCGAGAAGAGGCGGATCAACACGCTT
ATTGGCGAGCGTCGCACTCGACTGGGCGCCACTCTTGTCGACGTAACTCTCCAGGTCAAGCGTGAGGTCTACGGC
CAGAGCAGACTAGAGCACCTCTACCGTCAGCTCATCAACTGGACGTCGGACGACAACGTGCGGCGTATGTACGAA
GAGAAGTTGCTTCAGTACTGCCACGACCGCCTCTTGGTTCTTCCGTCCGCCGTCAAGCTCGAGCAGCAGAGCGTC
GTCATCGGCCTTGCGAGGGACATGGTCATCATCAAGCACCCCTTCAAGCTTGCATGGGACATTGCCGTCAACTGG
CAAGACAACAAGGAGATTTCAGACTGGGACGTCGATCTACTACGAAATTACTGCTCATTTTTCCCTGAATCCGAT
CTCTACAAGGTCATCACGGCCTATCTAACGAGCAGCTTCTCGCCCTTTCCCGAACTCAAGAAGCCGGATAACCAA
AACGCCTCGACTGCCCCGTCTGATGACAGTGAAGATGACGACGACGGCGGCGGCGCTCCCACCGCCTGGGTGCCG
TTGACGGAGGAGGACCGGCTGGTCATGATCACCGAGGGTATGAGCATGAGCGAATCGACTTTCGCGTATCGTCTC
GCTGGCCATTACTTTTTGCAGTTGGGCGAGTACGAGACCACTGTCGACTTTATGCGCAAAGCTCAGCAGTACGTG
ACCAAGGAACGTGCCTCAACGGGGCTCCCCTTTCGAGACACGCAAGACGCGTATTCGCTGTATCTCGCCACTGCT
TTGGTCTACTACCAATCCCCACGACATCATCAGGAAGCCAAGGCGTTGTTTGATGGCGTTCTCGAACATGACGAG
ACACGAACTTCGGCGCTGATTGGCGTCGGGCTAATATTCGAGGAGGAGCAAGACTATGACGAGGCCATCGACTTT
CTCAGCCGCGCTCTTGAGAGGGACGGATCCAACCTGCGCGTCAGATCAGAAGCTGCCTGGGTCAAGGCTCTCAAA
GGCGACTGGCAGACGGCCAAGGATGAGCTAATGTGCTGTATCGAACCCCTGGAATCGCAAGGAGTCATCGCTAAA
GAGCTGCTGGCGGACACTCAGTACCGCGTCGGCTGCTGCATCTGGAACCTCGAAACGGGCCGCCAGGCGAGAAAA
CAGAAGAAGGGAGAATGCGCCTATGCCTACTGGCTGACGGCTCTCGGGAACAACATGAAGCACGCCCCCTGTTAC
ACGAGCCTCGGCGTCTTCTATCGTGACTACGCCAAAGACCGGAACCGAGCCCGGCGCTGCTTTCAAAAGGCCCTC
GAGCTCTCGTCGGCCGAGGTGGTTTCCGCCCAGAGTCTGGCCCAGTCGTTCGCCGAAGACGCCGACTGGGAGCGC
GTCGAGCTCGTGGCGCGGAGAGTCGTCGATTCGGGCGTGGTGAGGCCGCCGCCGGGATCCAAGCGAAAGGGCATC
AGCTGGCCCTTCTCGGCGTTGGGCGTCGCCGAGCTGAACAAGCGAGACTTTCACAAGGCCATCGTCTCGTTCCAG
TCGGCCCTGAAGCTATCGCCGGACGACTATCACTCGTGGGTCGGGCTGGGCGAGAGCTACCACAGCTCCGGTCGG
TTCATGGCGGCTACCAAGGCCATCCTCAACGCCCAGGAGCTCGAGACAGATGGAAGAGACGTCTCTGCCGATACT
TGGTTCACCAAGTACATGCTTGCCAACATCAAGCGCGAGCTGGGCGAGTACGACGAATCCATGATCCTGTACCGG
TCCGTGCTGGAGACGCGGCCGGCAGAGGAGGGCGTGATCCTAGCCCTCATGCAGACGATGACGGAGAATGCGCTG
TCGAGCGTGGAAAATGGTCTATTTGGCAAGGCTGTACAGCTGGCCATCGACACCGTCCACGTCGCCGCAGATACG
GGGCCCAAGGTCAGGGGCACTTTCAACTTTTGGAAGAGTCTCGCCGAAGCCTGCTCCGTCTTTACGTTGGTTCAC
AGCCGGGCTGCGGATTTTCCCACTCAGGCTCTCAGGGGCCTGCTGGAAGCAAGCGATCAAGACGCGTACGACTTC
CTCGCCAACATCGATAAGATCGGGACCGACGTCGTCTACGCCAAGGGCATCTATGCCGAGGACGAGCAGCCGGGC
GTGGACCGGACGAGATGTGTCCACGCAACCATTCTCTGTCACAAGCAAGCCATCCACATCTCGTCGAGCGACCAG
CACGCCCAGGCCGTGGCTCACTACAACCTGGGCTGGGCAGAGTACCGGGCTCACGTCTGCCTGCCCCTTGACGTG
CGTCGCAAGCCAAGCAGCTATCTCCGGGCCTCGGTGCGAGCCCTGAAGCGATCCATCGAGCTGGAGAGCGGCAAC
GCCGAGTTCTGGAACGCCCTGGGCGTCGCAACCAGTGAGATCAACCCGGCCGTCTCGCAGCACGCCCTCGTCAGG
AGCCTGCACCTCAACGAGCGAAGCCCCGCGACGTGGACCAATCTAGGGACGCTGGCGCTGCTATCGAAGGATCTG
AAGCTGGCCAACGAGGCCTTAACCCGGGCGCAGTCGACGGATCCGGACTATGCGCACGCTTGGTTGGGGCAGGCC
TTCATCGCGTTGCTCGTGGGAGACGCCGACGAGGCTCGGAGCCTGTTCACGCACGCGCTGGACATTGCCGAGTCT
TGCTCCCTGCCGAGCCGACAGCACTATGCGGCGGCCGTCTTTGACCGCGTCTTATCATCCGGAGCTTCAGACTCG
TCGGTCGTATCATTGATCCAGCCGCTGTTTGCGCTCGGCCAGGTTCAGAGCCTGAGGCCGCAGGATCTCGTCTTC
ACCCACATGGCCACTCTCTTCCTGGAGCGGACACGGGAAAGTCCCCGCGCGATGCGCACCCTCAAGGACATGTGC
GGCGCCATCGAAGCTGACTACGAGACGACGGAGTCGGCCGATAGCCTGGTCAGGTTCACGCTCGCCAAGGCAGAT
CTGGCTCGGGCCTACCTGGCCGACGGTTCGTACGAGGAAGCTGTCGAGTGCGGCGAGACGGCGCTCGGGCTCAGC
GGAGAGGAGGGCGAGGGCGAGCTGACGGGCGAGCAGAGGAAGAGGGTCAGGCTCTCGGCGCAGCTGACGACGGGA
CTGGGGCACTTCTTCCTCGGCGCCTTTGACGAGGCCGAGAAGTGCTTCGAGGCCGCGCTTGAAGAATCGGGCGGC
GACCCAGACGCGGCCTGTCTCCTGGCGCAGGTTCTCTGGGCGCAAGGATCTGAAGCGTCGCGACAGAGGGCTCGG
AACACGCTTCTGGATGTGGTCGAGACGAGACCAGACCACGTGCAGAGCGTGCTGCTGCTAGGCACCGTGGCTCTT
GTCGACAACGACGAGGCCGGACTAGAAGCCGTGACCGAAGCGCTGCAGGGGCTGCGAGCCAGCGACGGCGTCACG
ACGACGGAGCAGAGCCAAGCATGCGACGTGCTGGGCGCCATAGCCATGAAGAGCGCTGGCGACGACGGCAGCTCA
CAGGAAGACGAGATGCTTGCCCAGCTGCAGACCGACATGATGCTGCGTCCACATCTGCCCGACGGCTGGGGCTCG
CTGGCCGAAGCGACGGGCGACGGACACGCGGCGGCCATGGCGCTCCGCGTCGCTGTCCGCGGTATCCCTCCGAGG
GGCGCCCTGGAGGCGGAACAGCTGGCGAGGGCGTATGCGGGCACTGGTCTGGCGGCAGACGCGCAACGGGCCATG
ATGGTTGCGCCGTGGGCTGCGGTCGGGAGGGAGGCGTTGAAGGCGGCGACGGAGGGCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail