Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1950
Gene name
LocationContig_189:14412..15357
Strand+
Gene length (bp)945
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase 1.1E-12 20 152

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42881|APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8E11.04c PE=3 SV=1 21 151 1.0E-12
sp|Q6CGL4|APTH1_YARLI Acyl-protein thioesterase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A18337g PE=3 SV=1 18 150 5.0E-12
sp|Q6BSS8|APTH1_DEBHA Acyl-protein thioesterase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2D06534g PE=3 SV=2 73 150 2.0E-07
sp|P0CL94|APTH1_CRYNJ Acyl-protein thioesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNF02430 PE=3 SV=1 22 165 4.0E-06
sp|P0CL95|APTH1_CRYNB Acyl-protein thioesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBF2260 PE=3 SV=1 22 165 4.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 113 135 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1950
MSSCFREPYYLAGRLQNPYYIINPSVAHTHTIIMLHDVASNGTMFGRDLMRLSVASTGRTLDRLYPSLRICMWFD
MARLIDPSFRQDLQREGLRNSARQIASLIDLEKRRVPVGNIVIGGLGQGCAMAIVVLLGLGHRLGGLIGISGYLP
FWFELEMVTAQDSSDEFEDDDDSFYEEEQDDDALSRDQGNDATPLEPCVKAQLFVRRLLDVGIPESPSRDQTSVD
TPIFLAHDDNRGMVSNRHGQHAALALEMAEYDVEFKTYWQPAGQPVPDELDDIVMFVRRNLGLTPRNYNHT*
Coding >Ophun1|1950
ATGTCTAGCTGCTTCCGCGAGCCGTACTACTTGGCGGGTCGGCTTCAAAACCCTTACTACATCATTAATCCTTCG
GTTGCGCACACGCATACCATCATTATGTTGCATGATGTCGCATCCAACGGTACCATGTTTGGTCGTGACCTCATG
CGTCTGAGCGTGGCTTCAACCGGCAGAACGCTCGACCGTCTTTATCCCAGCTTGCGAATCTGCATGTGGTTTGAC
ATGGCTCGCCTCATCGACCCGAGCTTCCGCCAGGATCTTCAGCGAGAGGGACTTCGCAATTCGGCTCGTCAGATC
GCCTCTCTCATCGACTTGGAGAAGAGGCGCGTGCCAGTCGGGAACATTGTCATCGGTGGTCTCGGTCAGGGCTGC
GCCATGGCTATCGTTGTCCTGCTGGGCCTTGGCCACAGACTTGGGGGCCTGATTGGTATAAGTGGTTACCTGCCG
TTTTGGTTCGAGCTTGAGATGGTTACTGCTCAAGACTCGTCAGATGAATTCGAAGATGACGATGACTCGTTTTAT
GAGGAAGAGCAGGATGACGACGCTCTCAGTCGCGACCAAGGTAACGATGCCACTCCGCTTGAGCCCTGCGTTAAA
GCTCAGTTATTCGTCAGACGTCTCCTGGACGTGGGAATCCCCGAATCCCCTTCTCGCGACCAGACGTCCGTTGAC
ACGCCCATCTTCTTGGCTCACGATGATAACAGGGGCATGGTCTCGAACCGTCACGGCCAGCACGCCGCCCTCGCC
TTGGAGATGGCCGAGTACGACGTCGAGTTCAAGACCTACTGGCAGCCAGCGGGCCAACCGGTTCCCGATGAGTTG
GATGACATCGTCATGTTCGTCCGCCGCAATCTTGGGTTGACGCCTCGCAACTACAACCACACGTAG
Transcript >Ophun1|1950
ATGTCTAGCTGCTTCCGCGAGCCGTACTACTTGGCGGGTCGGCTTCAAAACCCTTACTACATCATTAATCCTTCG
GTTGCGCACACGCATACCATCATTATGTTGCATGATGTCGCATCCAACGGTACCATGTTTGGTCGTGACCTCATG
CGTCTGAGCGTGGCTTCAACCGGCAGAACGCTCGACCGTCTTTATCCCAGCTTGCGAATCTGCATGTGGTTTGAC
ATGGCTCGCCTCATCGACCCGAGCTTCCGCCAGGATCTTCAGCGAGAGGGACTTCGCAATTCGGCTCGTCAGATC
GCCTCTCTCATCGACTTGGAGAAGAGGCGCGTGCCAGTCGGGAACATTGTCATCGGTGGTCTCGGTCAGGGCTGC
GCCATGGCTATCGTTGTCCTGCTGGGCCTTGGCCACAGACTTGGGGGCCTGATTGGTATAAGTGGTTACCTGCCG
TTTTGGTTCGAGCTTGAGATGGTTACTGCTCAAGACTCGTCAGATGAATTCGAAGATGACGATGACTCGTTTTAT
GAGGAAGAGCAGGATGACGACGCTCTCAGTCGCGACCAAGGTAACGATGCCACTCCGCTTGAGCCCTGCGTTAAA
GCTCAGTTATTCGTCAGACGTCTCCTGGACGTGGGAATCCCCGAATCCCCTTCTCGCGACCAGACGTCCGTTGAC
ACGCCCATCTTCTTGGCTCACGATGATAACAGGGGCATGGTCTCGAACCGTCACGGCCAGCACGCCGCCCTCGCC
TTGGAGATGGCCGAGTACGACGTCGAGTTCAAGACCTACTGGCAGCCAGCGGGCCAACCGGTTCCCGATGAGTTG
GATGACATCGTCATGTTCGTCCGCCGCAATCTTGGGTTGACGCCTCGCAACTACAACCACACGTAG
Gene >Ophun1|1950
ATGTCTAGCTGCTTCCGCGAGCCGTACTACTTGGCGGGTCGGCTTCAAAACCCTTACTACATCATTAATCCTTCG
GTTGCGCACACGCATACCATCATTATGTTGCATGATGTCGCATCCAACGGTACCATGTTTGGTCGTGACCTCATG
CGTCTGAGCGTGGCTTCAACCGGCAGAACGCTCGACCGTCTTTATCCCAGCGTGAGATTCATCTTCCCCACGGCT
AACCGGCGACCTTGCCATGCACAAAACCAGTTGCGAATCTGCATGTGGTTTGACATGGCTCGCCTCATCGACCCG
AGCTTCCGCCAGGATCTTCAGCGAGAGGGACTTCGCAATTCGGCTCGTCAGATCGCCTCTCTCATCGACTTGGAG
AAGAGGCGCGTGCCAGTCGGGAACATTGTCATCGGTGGTCTCGGTCAGGGCTGCGCCATGGCTATCGTTGTCCTG
CTGGGCCTTGGCCACAGACTTGGGGGCCTGATTGGTATAAGTGGTTACCTGCCGTTTTGGTTCGAGCTTGAGATG
GTTACTGCTCAAGACTCGTCAGATGAATTCGAAGATGACGATGACTCGTTTTATGAGGAAGAGCAGGATGACGAC
GCTCTCAGTCGCGACCAAGGTAACGATGCCACTCCGCTTGAGCCCTGCGTTAAAGCTCAGTTATTCGTCAGACGT
CTCCTGGACGTGGGAATCCCCGAATCCCCTTCTCGCGACCAGACGTCCGTTGACACGCCCATCTTCTTGGCTCAC
GATGATAACAGGGGCATGGTCTCGAACCGTCACGGCCAGCACGCCGCCCTCGCCTTGGAGATGGCCGAGTACGAC
GTCGAGTTCAAGACCTACTGGCAGCCAGCGGGCCAACCGGTTCCCGATGAGTTGGATGACATCGTCATGTTCGTC
CGCCGCAATCTTGGGTTGACGCCTCGCAACTACAACCACACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail