Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1948
Gene name
LocationContig_189:10504..12723
Strand+
Gene length (bp)2219
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 7.8E-48 329 518
PF00875 DNA_photolyase DNA photolyase 1.1E-13 9 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1Q6|CRYD_GIBZE Putative cryptochrome DASH OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_08852 PE=3 SV=1 4 552 0.0E+00
sp|Q7SI68|CRYD_NEUCR Putative cryptochrome DASH, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cry PE=3 SV=1 5 557 0.0E+00
sp|Q4KML2|CRYD_DANRE Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2 3 523 1.0E-89
sp|Q75WS4|CRYD_XENLA Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1 1 521 5.0E-87
sp|P77967|CRYD_SYNY3 Cryptochrome DASH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cry PE=1 SV=2 7 520 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1Q6|CRYD_GIBZE Putative cryptochrome DASH OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_08852 PE=3 SV=1 4 552 0.0E+00
sp|Q7SI68|CRYD_NEUCR Putative cryptochrome DASH, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cry PE=3 SV=1 5 557 0.0E+00
sp|Q4KML2|CRYD_DANRE Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2 3 523 1.0E-89
sp|Q75WS4|CRYD_XENLA Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1 1 521 5.0E-87
sp|P77967|CRYD_SYNY3 Cryptochrome DASH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cry PE=1 SV=2 7 520 1.0E-74
sp|Q7NMD1|CRYD_GLOVI Cryptochrome DASH OS=Gloeobacter violaceus (strain PCC 7421) GN=cry PE=3 SV=1 1 520 2.0E-71
sp|Q7UJB1|CRYD_RHOBA Cryptochrome DASH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cry PE=3 SV=2 12 521 3.0E-69
sp|Q5IFN2|CRYD_OSTTA Cryptochrome DASH, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=Ot01g06470 PE=3 SV=1 4 498 1.0E-66
sp|Q84KJ5|CRYD_ARATH Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=CRYD PE=1 SV=2 4 500 3.0E-62
sp|Q3IPX9|CRYD_NATPD Cryptochrome DASH OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=cry PE=3 SV=1 9 536 3.0E-62
sp|Q9KR33|CRYD_VIBCH Cryptochrome DASH OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry1 PE=1 SV=1 6 492 3.0E-58
sp|Q38JU2|CRYD_SOLLC Cryptochrome DASH, chloroplastic/mitochondrial OS=Solanum lycopersicum GN=CRYD PE=2 SV=2 9 553 6.0E-58
sp|Q651U1|CRYD_ORYSJ Cryptochrome DASH, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=CRYD PE=2 SV=1 4 505 2.0E-56
sp|Q5QXE0|CRYD_IDILO Cryptochrome DASH OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cry PE=3 SV=1 6 495 2.0E-56
sp|Q87JP5|CRYD_VIBPA Cryptochrome DASH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cry PE=3 SV=1 6 491 2.0E-50
sp|Q04449|PHR_BACPE Deoxyribodipyrimidine photo-lyase OS=Bacillus pseudofirmus (strain OF4) GN=phr PE=3 SV=2 1 514 4.0E-33
sp|A9CJC9|PHRA_AGRFC Deoxyribodipyrimidine photo-lyase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=phrA PE=1 SV=1 1 500 1.0E-30
sp|P12768|PHR_STRGR Deoxyribodipyrimidine photo-lyase OS=Streptomyces griseus GN=phr PE=3 SV=1 7 499 1.0E-28
sp|Q89AJ9|PHR_BUCBP Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=phrB PE=3 SV=1 12 498 2.0E-26
sp|P27526|PHR_NEUCR Deoxyribodipyrimidine photo-lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=phr PE=3 SV=2 243 498 9.0E-26
sp|Q9KNA8|PHR_VIBCH Deoxyribodipyrimidine photo-lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=phrA PE=1 SV=1 277 509 1.0E-24
sp|P61496|PHR_THET2 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=phr PE=1 SV=1 104 494 2.0E-24
sp|P05066|PHR_YEAST Deoxyribodipyrimidine photo-lyase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHR1 PE=1 SV=1 244 503 2.0E-24
sp|Q55081|PHR_SYNY3 Deoxyribodipyrimidine photo-lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=phrA PE=1 SV=1 7 499 5.0E-24
sp|P57386|PHR_BUCAI Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=phrB PE=3 SV=1 12 498 9.0E-23
sp|P61497|PHR_THET8 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=phr PE=1 SV=1 244 494 1.0E-22
sp|P40115|CRY1_SINAL Cryptochrome-1 OS=Sinapis alba GN=PHR1 PE=2 SV=1 1 556 1.0E-22
sp|P00914|PHR_ECOLI Deoxyribodipyrimidine photo-lyase OS=Escherichia coli (strain K12) GN=phrB PE=1 SV=1 241 498 3.0E-22
sp|P25078|PHR_SALTY Deoxyribodipyrimidine photo-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phrB PE=1 SV=2 200 498 4.0E-22
sp|Q96524|CRY2_ARATH Cryptochrome-2 OS=Arabidopsis thaliana GN=CRY2 PE=1 SV=2 1 534 5.0E-21
sp|Q9HQ46|PHR_HALSA Deoxyribodipyrimidine photo-lyase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phr PE=3 SV=2 243 508 7.0E-21
sp|P05327|PHR_SYNP6 Deoxyribodipyrimidine photo-lyase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=phr PE=1 SV=4 8 521 1.0E-20
sp|Q9KS67|CRY2_VIBCH Cryptochrome-like protein cry2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry2 PE=1 SV=1 243 512 3.0E-20
sp|O48652|UVR3_ARATH (6-4)DNA photolyase OS=Arabidopsis thaliana GN=UVR3 PE=1 SV=2 1 510 3.0E-20
sp|Q0E2Y1|UVR3_ORYSJ (6-4)DNA photolyase OS=Oryza sativa subsp. japonica GN=UVR3 PE=3 SV=1 241 510 4.0E-17
sp|Q17DK5|CRY1_AEDAE Cryptochrome-1 OS=Aedes aegypti GN=cry PE=3 SV=1 3 498 5.0E-16
sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana GN=CRY1 PE=1 SV=2 389 520 2.0E-15
sp|Q8QG60|CRY2_CHICK Cryptochrome-2 OS=Gallus gallus GN=CRY2 PE=2 SV=2 9 519 8.0E-15
sp|Q8LB72|PHR2_ARATH Blue-light photoreceptor PHR2 OS=Arabidopsis thaliana GN=PHR2 PE=2 SV=2 12 343 2.0E-14
sp|Q293P8|CRY1_DROPS Cryptochrome-1 OS=Drosophila pseudoobscura pseudoobscura GN=cry PE=3 SV=2 280 531 1.0E-12
sp|O77059|CRY1_DROME Cryptochrome-1 OS=Drosophila melanogaster GN=cry PE=1 SV=1 241 513 3.0E-12
sp|Q9R194|CRY2_MOUSE Cryptochrome-2 OS=Mus musculus GN=Cry2 PE=1 SV=1 1 519 4.0E-12
sp|Q49AN0|CRY2_HUMAN Cryptochrome-2 OS=Homo sapiens GN=CRY2 PE=1 SV=2 241 519 6.0E-12
sp|Q7PYI7|CRY1_ANOGA Cryptochrome-1 OS=Anopheles gambiae GN=Cry1 PE=2 SV=4 3 521 7.0E-12
sp|Q923I8|CRY2_RAT Cryptochrome-2 OS=Rattus norvegicus GN=Cry2 PE=1 SV=1 1 528 7.0E-12
sp|Q6ZZY0|CRY1_SYLBO Cryptochrome-1 OS=Sylvia borin GN=CRY1 PE=2 SV=1 9 519 1.0E-11
sp|Q5IZC5|CRY1_ERIRU Cryptochrome-1 OS=Erithacus rubecula GN=CRY1 PE=2 SV=2 9 519 1.0E-11
sp|Q8QG61|CRY1_CHICK Cryptochrome-1 OS=Gallus gallus GN=CRY1 PE=2 SV=1 9 519 1.0E-11
sp|Q16526|CRY1_HUMAN Cryptochrome-1 OS=Homo sapiens GN=CRY1 PE=1 SV=1 9 496 2.0E-11
sp|Q8WP19|CRY1_MACFA Cryptochrome-1 OS=Macaca fascicularis GN=CRY1 PE=2 SV=1 9 496 3.0E-11
sp|Q70AD6|CRY1_SPAJD Cryptochrome-1 OS=Spalax judaei GN=CRY1 PE=2 SV=1 9 496 4.0E-11
sp|Q32Q86|CRY1_RAT Cryptochrome-1 OS=Rattus norvegicus GN=Cry1 PE=1 SV=1 9 496 4.0E-11
sp|P97784|CRY1_MOUSE Cryptochrome-1 OS=Mus musculus GN=Cry1 PE=1 SV=1 9 496 1.0E-10
sp|B0WRR9|CRY1_CULQU Cryptochrome-1 OS=Culex quinquefasciatus GN=cry PE=3 SV=1 243 513 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7780
Ophiocordyceps australis map64 (Brazil) OphauB2|7449
Ophiocordyceps camponoti-floridani Ophcf2|06230
Ophiocordyceps camponoti-rufipedis Ophun1|1948 (this protein)
Ophiocordyceps kimflemingae Ophio5|2114
Ophiocordyceps subramaniannii Hirsu2|5603

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1948
MGTGNKLLVYLLRRDLRVSDNPVLHHLATSSDHGFTHLLPIYVFPARQIEVSGFLRQGQQSPYPPARSLAVWDLK
DSLEHVGSDLAIRVGDVKDVVSHLIRDFEGKSSKVGAVWMTEELSWEERQEQDEVASLCSDNGYLTFLDCLSRDT
GLSKPKDLPDVFTTYRKSQEPLRERPRSAFPAPSKSDLPPVPEESTIPSQDGPFDIPKSLDELEANLLQPLDDIL
SDPPQLSGEAQSSHPFRGGERRARERLNQLLKSGAVTTYKETRNGLLGADFSTKLSAYLALGCISARQVHEALLK
FEDGQDSTYQGAEGYGKGENDGTKGIRFELLWRDYMRLCTAKFGRKLFNLSGFTQDQSYGAKWKTANKKMAQTGQ
SPSPETVAKQLDRFHRGNTGMGLIDASQRELFLTGYTSNRARQNAASFLAKHLDIDWRYGAEWYEMMLVDYDVSS
NWANWQYVAGVGNDPRGDARIFNPVKQAFDYDKEGNYVRTWVPELKNLEKPENVFQVWTTSPEDLASAGLTDNIM
AMDPLKRIDFKLDRKPRSSRRPFQRKRGGQGRGGGRRGGGGGGGGPNGGGQHHGPSRSEKAMATNHDSSQATPDS
WEPRNGNGGKNYTSAHNQAAMTRDKQAYHGNMYVPSGFDNSVRWYPDQSMRGRGNHYGYFSGSERWYGYRPGFRD
MRYHQPPFAPMAAYPTMHPGPH*
Coding >Ophun1|1948
ATGGGTACCGGAAACAAGCTCCTCGTCTACCTGCTCCGCCGGGACCTGCGTGTGTCGGACAATCCCGTCCTCCAT
CACCTAGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCATCTACGTCTTTCCCGCACGCCAGATCGAA
GTCTCCGGCTTCCTCCGCCAGGGTCAGCAGTCTCCGTATCCGCCGGCCCGAAGTCTGGCCGTCTGGGATCTCAAG
GATAGTTTGGAGCATGTGGGGAGTGACCTGGCAATCCGCGTCGGCGATGTCAAGGATGTTGTCTCCCATCTGATA
CGCGACTTTGAAGGCAAGTCGTCCAAGGTGGGCGCCGTCTGGATGACGGAAGAGCTGTCCTGGGAAGAGCGTCAG
GAGCAAGATGAAGTTGCCTCATTGTGTTCAGACAATGGGTATCTGACTTTTCTCGACTGTCTCAGTCGCGATACG
GGTCTCTCAAAGCCGAAGGATCTCCCTGATGTCTTCACAACCTACCGCAAGTCGCAAGAGCCTCTTCGTGAGAGA
CCTCGAAGTGCGTTTCCGGCTCCTTCAAAGTCGGACTTGCCCCCTGTGCCCGAAGAGTCCACGATTCCAAGCCAA
GACGGCCCCTTTGATATCCCGAAATCGCTCGATGAACTCGAGGCAAACCTGTTGCAGCCCCTCGACGATATACTG
TCTGATCCGCCACAGTTGTCCGGCGAGGCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGTCGAGCCAGGGAG
CGCCTGAACCAACTTCTCAAGTCTGGCGCCGTCACGACATACAAAGAGACACGCAACGGCCTGCTCGGGGCCGAC
TTTAGCACCAAACTGTCTGCGTATCTGGCTCTGGGATGCATTTCCGCCAGACAGGTTCACGAGGCTTTACTGAAG
TTTGAAGACGGACAAGACTCGACGTACCAGGGGGCTGAGGGCTACGGCAAAGGCGAAAATGACGGCACCAAGGGA
ATTCGGTTTGAACTGCTCTGGCGCGACTATATGCGGTTGTGTACAGCCAAGTTTGGTCGGAAGCTGTTCAACCTG
TCGGGCTTCACGCAGGACCAGAGCTACGGTGCCAAGTGGAAGACAGCCAACAAGAAGATGGCCCAGACCGGTCAA
TCACCGTCACCTGAGACGGTCGCGAAACAGTTGGATCGCTTTCACAGAGGCAACACTGGCATGGGTCTCATCGAT
GCCTCACAGCGGGAGCTCTTCCTCACTGGATACACGTCCAACAGGGCCAGACAGAACGCCGCCAGCTTCCTGGCC
AAACACCTCGACATTGATTGGCGTTACGGGGCGGAGTGGTACGAGATGATGCTCGTCGACTACGACGTCTCGTCC
AACTGGGCCAACTGGCAGTACGTTGCGGGCGTGGGCAACGACCCAAGGGGTGACGCTCGCATTTTCAACCCTGTC
AAGCAAGCCTTTGACTACGACAAGGAGGGAAACTACGTGCGCACTTGGGTTCCTGAGTTGAAGAACTTGGAAAAG
CCCGAAAACGTCTTCCAAGTGTGGACCACCAGCCCCGAAGATTTGGCCAGCGCCGGCCTCACAGACAACATCATG
GCAATGGATCCCTTGAAGCGGATAGACTTCAAACTCGATCGGAAGCCTCGCAGTTCCAGAAGACCGTTCCAGCGG
AAACGCGGTGGCCAGGGTCGAGGTGGAGGTCGTCGAGGCGGAGGTGGTGGAGGAGGTGGTCCAAATGGCGGTGGC
CAACATCACGGACCAAGTCGTTCCGAGAAGGCCATGGCCACAAACCACGACAGTTCCCAGGCGACGCCTGATTCG
TGGGAGCCACGCAACGGCAACGGCGGCAAGAATTATACATCGGCTCACAACCAAGCCGCCATGACCCGCGATAAG
CAGGCGTATCATGGAAACATGTATGTTCCGAGCGGTTTTGACAACAGCGTTCGCTGGTACCCCGATCAGAGCATG
CGCGGACGCGGGAACCATTATGGCTACTTTAGCGGAAGCGAACGCTGGTATGGCTACAGACCGGGATTCAGGGAC
ATGAGATACCACCAGCCGCCGTTTGCACCTATGGCGGCATATCCGACCATGCACCCGGGGCCACACTAG
Transcript >Ophun1|1948
ATGGGTACCGGAAACAAGCTCCTCGTCTACCTGCTCCGCCGGGACCTGCGTGTGTCGGACAATCCCGTCCTCCAT
CACCTAGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCATCTACGTCTTTCCCGCACGCCAGATCGAA
GTCTCCGGCTTCCTCCGCCAGGGTCAGCAGTCTCCGTATCCGCCGGCCCGAAGTCTGGCCGTCTGGGATCTCAAG
GATAGTTTGGAGCATGTGGGGAGTGACCTGGCAATCCGCGTCGGCGATGTCAAGGATGTTGTCTCCCATCTGATA
CGCGACTTTGAAGGCAAGTCGTCCAAGGTGGGCGCCGTCTGGATGACGGAAGAGCTGTCCTGGGAAGAGCGTCAG
GAGCAAGATGAAGTTGCCTCATTGTGTTCAGACAATGGGTATCTGACTTTTCTCGACTGTCTCAGTCGCGATACG
GGTCTCTCAAAGCCGAAGGATCTCCCTGATGTCTTCACAACCTACCGCAAGTCGCAAGAGCCTCTTCGTGAGAGA
CCTCGAAGTGCGTTTCCGGCTCCTTCAAAGTCGGACTTGCCCCCTGTGCCCGAAGAGTCCACGATTCCAAGCCAA
GACGGCCCCTTTGATATCCCGAAATCGCTCGATGAACTCGAGGCAAACCTGTTGCAGCCCCTCGACGATATACTG
TCTGATCCGCCACAGTTGTCCGGCGAGGCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGTCGAGCCAGGGAG
CGCCTGAACCAACTTCTCAAGTCTGGCGCCGTCACGACATACAAAGAGACACGCAACGGCCTGCTCGGGGCCGAC
TTTAGCACCAAACTGTCTGCGTATCTGGCTCTGGGATGCATTTCCGCCAGACAGGTTCACGAGGCTTTACTGAAG
TTTGAAGACGGACAAGACTCGACGTACCAGGGGGCTGAGGGCTACGGCAAAGGCGAAAATGACGGCACCAAGGGA
ATTCGGTTTGAACTGCTCTGGCGCGACTATATGCGGTTGTGTACAGCCAAGTTTGGTCGGAAGCTGTTCAACCTG
TCGGGCTTCACGCAGGACCAGAGCTACGGTGCCAAGTGGAAGACAGCCAACAAGAAGATGGCCCAGACCGGTCAA
TCACCGTCACCTGAGACGGTCGCGAAACAGTTGGATCGCTTTCACAGAGGCAACACTGGCATGGGTCTCATCGAT
GCCTCACAGCGGGAGCTCTTCCTCACTGGATACACGTCCAACAGGGCCAGACAGAACGCCGCCAGCTTCCTGGCC
AAACACCTCGACATTGATTGGCGTTACGGGGCGGAGTGGTACGAGATGATGCTCGTCGACTACGACGTCTCGTCC
AACTGGGCCAACTGGCAGTACGTTGCGGGCGTGGGCAACGACCCAAGGGGTGACGCTCGCATTTTCAACCCTGTC
AAGCAAGCCTTTGACTACGACAAGGAGGGAAACTACGTGCGCACTTGGGTTCCTGAGTTGAAGAACTTGGAAAAG
CCCGAAAACGTCTTCCAAGTGTGGACCACCAGCCCCGAAGATTTGGCCAGCGCCGGCCTCACAGACAACATCATG
GCAATGGATCCCTTGAAGCGGATAGACTTCAAACTCGATCGGAAGCCTCGCAGTTCCAGAAGACCGTTCCAGCGG
AAACGCGGTGGCCAGGGTCGAGGTGGAGGTCGTCGAGGCGGAGGTGGTGGAGGAGGTGGTCCAAATGGCGGTGGC
CAACATCACGGACCAAGTCGTTCCGAGAAGGCCATGGCCACAAACCACGACAGTTCCCAGGCGACGCCTGATTCG
TGGGAGCCACGCAACGGCAACGGCGGCAAGAATTATACATCGGCTCACAACCAAGCCGCCATGACCCGCGATAAG
CAGGCGTATCATGGAAACATGTATGTTCCGAGCGGTTTTGACAACAGCGTTCGCTGGTACCCCGATCAGAGCATG
CGCGGACGCGGGAACCATTATGGCTACTTTAGCGGAAGCGAACGCTGGTATGGCTACAGACCGGGATTCAGGGAC
ATGAGATACCACCAGCCGCCGTTTGCACCTATGGCGGCATATCCGACCATGCACCCGGGGCCACACTAG
Gene >Ophun1|1948
ATGGGTACCGGAAACAAGCTCCTCGTCTACCTGCTCCGCCGGGACCTGCGTGTGTCGGACAATCCCGTCCTCCAT
CACCTAGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCATCTACGTCTTTCCCGCACGCCAGATCGAA
GTCTCCGGCTTCCTCCGCCAGGGTCAGCAGTCTCCGTATCCGCCGGCCCGAAGTCTGGTCGGTGGGTATTGGAGA
TGCGGGCCTCATCGGGCCAAGTTTATTGCACAGGCCGTCTGGGATCTCAAGGATAGTTTGGAGCATGTGGGGAGT
GACCTGGCAATCCGCGTCGGCGATGTCAAGGATGTTGTCTCCCATCTGATACGCGACTTTGAAGGCAAGTCGTCC
AAGGTGGGCGCCGTCTGGATGACGGAAGAGCTGTCCTGGGAAGAGCGTCAGGAGCAAGATGAAGTTGCCTCATTG
TGTTCAGACAATGGGGTAGATTTTAAACTGTGGCCGGATGAGAAATATTTCATCGACGAGTGAGACCCCTGAACC
AAGCTGTCTGGCAGTATCTGACTTTTCTCGACTGTCTCAGTCGCGATACGGGTCTCTCAAAGCCGAAGGATCTCC
CTGATGTCTTCACAACCTACCGCAAGTCGCAAGAGCCTCTTCGTGAGAGACCTCGAAGTGCGTTTCCGGCTCCTT
CAAAGTCGGACTTGCCCCCTGTGCCCGAAGAGTCCACGATTCCAAGCCAAGACGGCCCCTTTGATATCCCGAAAT
CGCTCGATGAACTCGAGGCAAACCTGTTGCAGCCCCTCGACGATATACTGTCTGATCCGCCACAGTTGTCCGGCG
AGGCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGTCGAGCCAGGGAGCGCCTGAACCAACTTCTCAAGTCTG
GCGCCGTCACGACATACAAAGAGACACGCAACGGCCTGCTCGGGGCCGACTTTAGCACCAAACTGTCTGCGTATC
TGGCTCTGGGATGCATTTCCGCCAGACAGGTTCACGAGGCTTTACTGAAGTTTGAAGACGGACAAGACTCGACGT
ACCAGGGGGCTGAGGGCTACGGCAAAGGCGAAAATGACGGCACCAAGGGAATTCGGTTTGAACTGCTCTGGCGCG
ACTATATGCGGTTGTGTACAGCCAAGTTTGGTCGGAAGCTGTTCAACCTGTCGGGCTTCACGCAGGACCAGAGCT
ACGGTGCCAAGTGGAAGACAGCCAACAAGAAGATGGCCCAGACCGGTCAATCACCGTCACCTGAGACGGTCGCGA
AACAGTTGGATCGCTTTCACAGAGGCAACACTGGCATGGGTCTCATCGATGCCTCACAGCGGGAGCTCTTCCTCA
CTGGATACACGTCCAACAGGGCCAGACAGAACGCCGCCAGCTTCCTGGCCAAACACCTCGACATTGATTGGCGTT
ACGGGGCGGAGTGGTACGAGATGATGCTCGTCGACTACGACGTCTCGTCCAACTGGGCCAACTGGCAGTACGTTG
CGGGCGTGGGCAACGACCCAAGGGGTGACGCTCGCATTTTCAACCCTGTCAAGCAAGCCTTTGACTACGACAAGG
AGGGAAACTACGTGCGCACTTGGGTTCCTGAGTTGAAGAACTTGGAAAAGCCCGAAAACGTCTTCCAAGTGTGGA
CCACCAGCCCCGAAGATTTGGCCAGCGCCGGCCTCACAGACAACATCATGGCAATGGATCCCTTGAAGCGGATAG
ACTTCAAACTCGATCGGAAGCCTCGCAGTTCCAGAAGACCGTTCCAGCGGAAACGCGGTGGCCAGGGTCGAGGTG
GAGGTCGTCGAGGCGGAGGTGGTGGAGGAGGTGGTCCAAATGGCGGTGGCCAACATCACGGACCAAGTCGTTCCG
AGAAGGCCATGGCCACAAACCACGACAGTTCCCAGGCGACGCCTGATTCGTGGGAGCCACGCAACGGCAACGGCG
GCAAGAATTATACATCGGCTCACAACCAAGCCGCCATGACCCGCGATAAGCAGGCGTATCATGGAAACATGTATG
TTCCGAGCGGTTTTGACAACAGCGTTCGCTGGTACCCCGATCAGAGCATGCGCGGACGCGGGAACCATTATGGCT
ACTTTAGCGGAAGCGAACGCTGGTATGGCTACAGACCGGGATTCAGGGACATGAGATACCACCAGCCGCCGTTTG
CACCTATGGCGGCATATCCGACCATGCACCCGGGGCCACACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail