Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1932
Gene name
LocationContig_188:13930..15103
Strand+
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 8.7E-27 137 350
PF01731 Arylesterase Arylesterase 1.3E-05 225 267

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01578|GNL_ZYMMO Gluconolactonase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gnl PE=1 SV=2 128 363 1.0E-15
sp|Q9M1B4|SSL13_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 13 OS=Arabidopsis thaliana GN=SSL13 PE=1 SV=1 167 321 4.0E-07

GO

GO Term Description Terminal node
GO:0004064 arylesterase activity Yes
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6193
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06923
Ophiocordyceps camponoti-rufipedis Ophun1|1932 (this protein)
Ophiocordyceps kimflemingae Ophio5|2652
Ophiocordyceps subramaniannii Hirsu2|5950

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1932
MATLATTQFGFASIAFDTFQAADMSSVNISAVFGVDLTAAATDALYFAKLPAPAIELRSYHNDFANVLGPDASAR
MVWDVDWEAFHEAGVYHRPSNSLYISSNFKSLDDPINMTIVSLDSDDYPFRSVRIAGLAMPNGGTTYRLPGINWP
GPSRTQVYCDEGDFEHYSQLVVLDPSTGVSWPILTSYLGRNFSSINDVRQHPVTGDLWFTDADYGYFQHFRPKPT
ISKHVYRFEPQSGRVQVVADGFVQPNGIEFSPDQKTLYVSDTGSQQFDVVPGQPSTIYAYDIVGKRRLMNRRVFA
YLDSGFPDGMHCDTEGNLWVAGGDGVHIFNIHGELLGKIYIGETSNNFAFAPGKVFIFSNHRLWVVENINALGRE
VCDDFDLEHRVCRKR*
Coding >Ophun1|1932
ATGGCGACACTCGCGACCACACAGTTTGGCTTCGCCTCGATAGCCTTCGATACGTTTCAAGCAGCTGACATGAGT
TCGGTCAACATCTCGGCCGTCTTCGGCGTCGACTTGACGGCCGCCGCTACCGACGCCCTTTATTTCGCCAAGCTG
CCGGCGCCGGCCATCGAGCTGCGGTCCTACCACAACGATTTCGCCAACGTTCTGGGTCCGGATGCCAGTGCCCGC
ATGGTATGGGATGTGGACTGGGAGGCCTTTCACGAGGCCGGGGTATACCATCGGCCAAGCAACTCTCTATACATA
TCCTCAAACTTCAAGAGCCTCGACGACCCCATCAACATGACCATCGTCTCCCTGGATTCGGACGATTACCCATTC
AGGAGCGTCCGCATTGCCGGCCTGGCCATGCCTAACGGGGGTACCACTTACCGTCTTCCAGGCATCAATTGGCCT
GGCCCCTCGCGGACGCAAGTCTACTGCGATGAAGGAGACTTTGAGCACTACTCGCAGCTCGTCGTCCTCGACCCC
AGCACCGGTGTGTCGTGGCCCATTCTTACTAGCTACCTCGGACGAAACTTCTCCTCCATCAACGATGTGCGTCAG
CATCCCGTAACTGGCGACCTGTGGTTTACCGACGCTGATTACGGATACTTCCAACACTTTCGACCCAAGCCGACG
ATCTCAAAGCACGTCTATCGCTTCGAACCACAATCCGGTAGAGTCCAGGTCGTCGCAGACGGCTTCGTACAGCCA
AATGGCATCGAATTCTCTCCCGACCAGAAGACCCTCTACGTCTCCGACACTGGCAGCCAGCAGTTTGATGTAGTA
CCAGGGCAGCCTTCAACAATCTACGCCTACGATATCGTCGGGAAAAGGCGGCTCATGAACCGGAGGGTGTTTGCC
TATCTTGACTCGGGGTTCCCTGATGGAATGCACTGCGACACCGAGGGCAACTTGTGGGTGGCAGGCGGTGATGGC
GTCCACATCTTTAATATTCATGGCGAGCTCCTTGGCAAAATATACATTGGCGAGACCAGCAATAACTTTGCATTT
GCCCCGGGCAAGGTTTTCATCTTCTCCAACCATCGACTTTGGGTTGTCGAGAACATCAACGCCCTCGGCCGGGAA
GTCTGTGACGACTTTGATCTCGAACACAGAGTTTGCAGGAAACGATAG
Transcript >Ophun1|1932
ATGGCGACACTCGCGACCACACAGTTTGGCTTCGCCTCGATAGCCTTCGATACGTTTCAAGCAGCTGACATGAGT
TCGGTCAACATCTCGGCCGTCTTCGGCGTCGACTTGACGGCCGCCGCTACCGACGCCCTTTATTTCGCCAAGCTG
CCGGCGCCGGCCATCGAGCTGCGGTCCTACCACAACGATTTCGCCAACGTTCTGGGTCCGGATGCCAGTGCCCGC
ATGGTATGGGATGTGGACTGGGAGGCCTTTCACGAGGCCGGGGTATACCATCGGCCAAGCAACTCTCTATACATA
TCCTCAAACTTCAAGAGCCTCGACGACCCCATCAACATGACCATCGTCTCCCTGGATTCGGACGATTACCCATTC
AGGAGCGTCCGCATTGCCGGCCTGGCCATGCCTAACGGGGGTACCACTTACCGTCTTCCAGGCATCAATTGGCCT
GGCCCCTCGCGGACGCAAGTCTACTGCGATGAAGGAGACTTTGAGCACTACTCGCAGCTCGTCGTCCTCGACCCC
AGCACCGGTGTGTCGTGGCCCATTCTTACTAGCTACCTCGGACGAAACTTCTCCTCCATCAACGATGTGCGTCAG
CATCCCGTAACTGGCGACCTGTGGTTTACCGACGCTGATTACGGATACTTCCAACACTTTCGACCCAAGCCGACG
ATCTCAAAGCACGTCTATCGCTTCGAACCACAATCCGGTAGAGTCCAGGTCGTCGCAGACGGCTTCGTACAGCCA
AATGGCATCGAATTCTCTCCCGACCAGAAGACCCTCTACGTCTCCGACACTGGCAGCCAGCAGTTTGATGTAGTA
CCAGGGCAGCCTTCAACAATCTACGCCTACGATATCGTCGGGAAAAGGCGGCTCATGAACCGGAGGGTGTTTGCC
TATCTTGACTCGGGGTTCCCTGATGGAATGCACTGCGACACCGAGGGCAACTTGTGGGTGGCAGGCGGTGATGGC
GTCCACATCTTTAATATTCATGGCGAGCTCCTTGGCAAAATATACATTGGCGAGACCAGCAATAACTTTGCATTT
GCCCCGGGCAAGGTTTTCATCTTCTCCAACCATCGACTTTGGGTTGTCGAGAACATCAACGCCCTCGGCCGGGAA
GTCTGTGACGACTTTGATCTCGAACACAGAGTTTGCAGGAAACGATAG
Gene >Ophun1|1932
ATGGCGACACTCGCGACCACACAGTTTGGCTTCGCCTCGATAGCCTTCGATACGTTTCAAGCAGCTGACATGAGT
TCGGTCAACATCTCGGCCGTCTTCGGCGTCGACTTGACGGCCGCCGCTACCGACGCCCTTTATTTCGCCAAGCTG
CCGGCGCCGGCCATCGAGCTGCGGTCCTACCACAACGATTTCGCCAACGTTCTGGGTCCGGATGCCAGTGCCCGC
ATGGTATGGGATGTGGACTGGGAGGCCTTTCACGAGGCCGGGGTATACCATCGGCCAAGCAACTCTCTATACATA
TCCTCAAACTTCAAGAGCCTCGACGACCCCATCAACATGACCATCGTCTCCCTGGATTCGGACGATTACCCATTC
AGGAGCGTCCGCATTGCCGGCCTGGCCATGCCTAACGGGGGTACCACTTACCGTCTTCCAGGCATCAATTGGCCT
GGCCCCTCGCGGACGCAAGTCTACTGCGATGAAGGAGACTTTGAGCACTACTCGCAGCTCGTCGTCCTCGACCCC
AGCACCGGTGTGTCGTGGCCCATTCTTACTAGCTACCTCGGACGAAACTTCTCCTCCATCAACGATGTGCGTCAG
CATCCCGTAACTGGCGACCTGTGGTTTACCGACGCTGATTACGGATACTTCCAACACTTTCGACCCAAGCCGACG
ATCTCAAAGCACGTCTATCGCTTCGAACCACAATCCGGTAGAGTCCAGGTCGTCGCAGACGGCTTCGTACAGCCA
AATGGCATCGAATTCTCTCCCGACCAGAAGACCCTCTACGTCTCCGACACTGGCAGCCAGCAGTTTGATGTAGTA
CCAGGGCAGCCTTCAACAATCTACGCCTACGATATCGTCGGGAAAAGGCGGCTCATGAACCGGAGGGTGTTTGCC
TATCTTGACTCGGGGTTCCCTGATGGAATGCACTGCGACACCGAGGGCAACTTGTGGGTGGCAGGCGGTGATGGC
GTCCACATCTTTAATATTCATGGCGAGCTCCTTGGCAAAATATACATTGGCGAGACCAGCAATAACTTTGCATTT
GCCCCGGGCAAGGTTTTCATCTTCTCCAACCATCGACTTTGGGTTGTCGAGAACATCAACGCCCTCGGCCGGGAA
GTCTGTGACGACTTTGATCTCGAACACAGAGTTTGCAGGAAACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail