Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1925
Gene name
LocationContig_187:27257..29119
Strand-
Gene length (bp)1862
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13938|YEP4_SCHPO UPF0658 Golgi apparatus membrane protein C23H3.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.04 PE=3 SV=3 91 401 1.0E-44
sp|Q9UUJ8|YLOA_SCHPO UPF0658 Golgi apparatus membrane protein C1952.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.10c PE=3 SV=1 77 431 4.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 142 161 19
3 168 190 22
4 222 244 22
5 270 292 22
6 302 321 19
7 328 346 18
8 366 388 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1925
MARETLPPGFSLHSPFALFSSPVLATRTSSLDYNSKYSREFGQAYPQPAYSQPAYAENANLNAGFDQGYAYRQGL
ASSNPARSVYRDRMSFLKSKWPAAFMAVASLQAIVCLAFESFVFACFQSSLGRWDNKPDVQSQYKTIPTFLTLII
FGFLYELVVVWDALRMKNTIQVIGVCIANLALLVYTAIQVDQIQMAISTLGIAALKPGITPDQVWSQARPFLVAI
PAIIALATAAMVFIAWKLYQEFAWDILKNIGADYRMKKRFLHYQIYIALLKFDFFFFLGFIIQFVVIVAQKTDPE
FALTIATIPVTICILLAAAYFTRRENKLGMMAVIILYLGGLIYFIFKLVRIYQPAYRLFYLPVRKSLTAFAVITI
LLILLTIANAVICMGNFDKGLKAHLLTPRRMDEKPDAHSISLHDVKPQIPSRMTID*
Coding >Ophun1|1925
ATGGCGCGTGAGACGCTACCGCCGGGCTTTTCGTTGCATTCTCCGTTCGCACTGTTCTCGTCGCCCGTCCTGGCT
ACCAGGACGTCGTCTCTCGATTACAACTCAAAGTACTCGCGCGAATTCGGCCAGGCCTACCCGCAGCCCGCATAC
TCGCAGCCCGCATACGCGGAGAATGCCAATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGGCCTG
GCCTCGTCCAACCCGGCCAGGAGCGTCTACCGCGACAGGATGAGCTTCCTCAAGTCCAAATGGCCCGCCGCCTTC
ATGGCCGTCGCCAGTCTCCAGGCCATCGTTTGCCTGGCATTTGAGTCATTTGTCTTTGCTTGCTTCCAGTCGAGC
CTTGGCCGTTGGGACAACAAACCCGACGTTCAGTCCCAATACAAGACGATTCCCACCTTCTTGACCCTCATCATC
TTTGGCTTCCTGTACGAGCTGGTCGTCGTCTGGGATGCGCTGCGGATGAAGAACACCATCCAGGTCATTGGCGTA
TGCATCGCCAACCTGGCCCTGCTCGTCTACACCGCCATCCAGGTCGACCAGATTCAAATGGCCATCAGCACCCTC
GGTATCGCCGCCCTAAAGCCCGGCATCACCCCGGACCAGGTCTGGTCTCAGGCCAGGCCCTTCCTCGTCGCCATC
CCTGCCATCATCGCCCTCGCCACCGCCGCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGAT
ATTCTCAAGAACATTGGCGCCGACTACCGCATGAAGAAGCGCTTCCTTCACTATCAGATCTATATTGCCCTCCTC
AAGTTCGACTTCTTCTTCTTCCTCGGCTTCATCATCCAATTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAG
TTCGCCCTTACCATCGCCACCATCCCCGTCACCATCTGCATCCTACTCGCCGCCGCCTACTTCACCCGCCGCGAG
AACAAGCTCGGCATGATGGCCGTCATCATCCTCTACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGC
ATCTATCAGCCCGCCTATAGGCTCTTCTACCTACCCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATC
CTATTGATCCTCCTCACCATTGCAAATGCCGTCATCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTA
CTCACCCCCCGCCGGATGGACGAGAAGCCCGATGCGCACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCC
AGCCGGATGACCATCGACTAA
Transcript >Ophun1|1925
ATGGCGCGTGAGACGCTACCGCCGGGCTTTTCGTTGCATTCTCCGTTCGCACTGTTCTCGTCGCCCGTCCTGGCT
ACCAGGACGTCGTCTCTCGATTACAACTCAAAGTACTCGCGCGAATTCGGCCAGGCCTACCCGCAGCCCGCATAC
TCGCAGCCCGCATACGCGGAGAATGCCAATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGGCCTG
GCCTCGTCCAACCCGGCCAGGAGCGTCTACCGCGACAGGATGAGCTTCCTCAAGTCCAAATGGCCCGCCGCCTTC
ATGGCCGTCGCCAGTCTCCAGGCCATCGTTTGCCTGGCATTTGAGTCATTTGTCTTTGCTTGCTTCCAGTCGAGC
CTTGGCCGTTGGGACAACAAACCCGACGTTCAGTCCCAATACAAGACGATTCCCACCTTCTTGACCCTCATCATC
TTTGGCTTCCTGTACGAGCTGGTCGTCGTCTGGGATGCGCTGCGGATGAAGAACACCATCCAGGTCATTGGCGTA
TGCATCGCCAACCTGGCCCTGCTCGTCTACACCGCCATCCAGGTCGACCAGATTCAAATGGCCATCAGCACCCTC
GGTATCGCCGCCCTAAAGCCCGGCATCACCCCGGACCAGGTCTGGTCTCAGGCCAGGCCCTTCCTCGTCGCCATC
CCTGCCATCATCGCCCTCGCCACCGCCGCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGAT
ATTCTCAAGAACATTGGCGCCGACTACCGCATGAAGAAGCGCTTCCTTCACTATCAGATCTATATTGCCCTCCTC
AAGTTCGACTTCTTCTTCTTCCTCGGCTTCATCATCCAATTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAG
TTCGCCCTTACCATCGCCACCATCCCCGTCACCATCTGCATCCTACTCGCCGCCGCCTACTTCACCCGCCGCGAG
AACAAGCTCGGCATGATGGCCGTCATCATCCTCTACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGC
ATCTATCAGCCCGCCTATAGGCTCTTCTACCTACCCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATC
CTATTGATCCTCCTCACCATTGCAAATGCCGTCATCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTA
CTCACCCCCCGCCGGATGGACGAGAAGCCCGATGCGCACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCC
AGCCGGATGACCATCGACTAA
Gene >Ophun1|1925
ATGGCGCGTGAGACGCTACCGCCGGGCTTTTCGTTGCATTCTCCGTTCGCACTGTTCTCGGTACAACATCACGCG
CCCGTTTCCCGCTCCGTTCTTGCGCCACCCTCGTTCTCCTCGTTTATCCATCATCGTCACTCTCATCCACAGTCT
CTCGTTCAGCCGGCACGCCTGTCATTCGTCCTTTCTTTTCAAACGAGTCCGCTCCTCTGAGAAACCTCTACTTCA
CTTCCTACGGGTGTCCTCGACTTCGCCACAACATCAAGATAAAAATAACCCACCGAGAAAAAAAAGCAAAGAAAC
GGAGGCCCAGAAAAAAGCGCATCTCACCACCCCTTCACCCTTCCAATCTATCCCGCTCTCGCCCGCCATCGACTA
CGACGACGACGACGACGAGACGACGACAACTACAACGATTCCCCAGACGTCGAATCCCCGCTGACTCCCGGTCGG
AGTCGCCCAGTCGCCCGTCCTGGCTACCAGGTCAGATTCCGCTCCCCCCTTCCGCTCTTCTCTCTCCCGCTCACG
TCGCAGCAGGACGTCGTCTCTCGATTACAACTCAAAGTACTCGCGCGAATTCGGCCAGGCCTACCCGCAGCCCGC
ATACTCGCAGCCCGCATACGCGGAGAATGCCAATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGG
CCTGGCCTCGTCCAACCCGGCCAGGAGCGTCTACCGCGACAGGATGAGCTTCCTCAAGTCCAAATGGCCCGCCGC
CTTCATGGCCGTCGCCAGTCTCCAGGCCATCGTTTGCCTGGCATTTGAGTCGTACGCCACCTGTCGTCACCCCCT
TGGACGCCCGCTTACCCGCTTGTGACAGATTTGTCTTTGCTTGCTTCCAGTCGAGCCTTGGCCGTTGGGACAACA
AACCCGACGTTCAGTCCCAATACAAGACGATTCCCACCTTCTTGACCCTCATCATCTTTGGCTTCCTGTACGAGC
TGGTCGTCGTCTGGGATGCGCTGCGGATGAAGAACACCATCCAGGTCATTGGCGTATGCATCGCCAACCTGGCCC
TGCTCGTCTACACCGCCATCCAGGTCGACCAGATTCAAATGGCCATCAGCACCCTCGGTATCGCCGCCCTAAAGC
CCGGCATCACCCCGGACCAGGTCTGGTCTCAGGCCAGGCCCTTCCTCGTCGCCATCCCTGCCATCATCGCCCTCG
CCACCGCCGCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGATATTCTCAAGAACATTGGCG
CCGACTACCGCATGAAGAAGCGCTTCCTTCACTATCAGGTTCGTCACCAATATCGTCTCATCGACACTGCCAACG
CAAGACTCACCCCCTCTTCCCAGATCTATATTGCCCTCCTCAAGTTCGACTTCTTCTTCTTCCTCGGCTTCATCA
TCCAATTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAGTTCGCCCTTACCATCGCCACCATCCCCGTCACCA
TCTGCATCCTACTCGCCGCCGCCTACTTCACCCGCCGCGAGAACAAGCTCGGCATGATGGCCGTCATCATCCTCT
ACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGCATCTATCAGCCCGCCTATAGGCTCTTCTACCTAC
CCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATCCTATTGATCCTCCTCACCATTGCAAATGCCGTCA
TCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTACTCACCCCCCGCCGGATGGACGAGAAGCCCGATG
CGCACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCCAGCCGGATGACCATCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail