Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1924
Gene name
LocationContig_187:25054..26474
Strand+
Gene length (bp)1420
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10607 CTLH CTLH/CRA C-terminal to LisH motif domain 2.1E-29 191 343
PF13445 zf-RING_UBOX RING-type zinc-finger 1.0E-07 381 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H871|RMD5A_HUMAN Protein RMD5 homolog A OS=Homo sapiens GN=RMND5A PE=1 SV=1 57 436 1.0E-52
sp|Q80YQ8|RMD5A_MOUSE Protein RMD5 homolog A OS=Mus musculus GN=Rmnd5a PE=1 SV=2 57 436 1.0E-52
sp|Q6GLP4|RMD5A_XENLA Protein RMD5 homolog A OS=Xenopus laevis GN=rmnd5a PE=2 SV=1 20 436 9.0E-52
sp|Q91YQ7|RMD5B_MOUSE Protein RMD5 homolog B OS=Mus musculus GN=Rmnd5b PE=2 SV=1 57 436 1.0E-50
sp|Q96G75|RMD5B_HUMAN Protein RMD5 homolog B OS=Homo sapiens GN=RMND5B PE=1 SV=1 57 436 4.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H871|RMD5A_HUMAN Protein RMD5 homolog A OS=Homo sapiens GN=RMND5A PE=1 SV=1 57 436 1.0E-52
sp|Q80YQ8|RMD5A_MOUSE Protein RMD5 homolog A OS=Mus musculus GN=Rmnd5a PE=1 SV=2 57 436 1.0E-52
sp|Q6GLP4|RMD5A_XENLA Protein RMD5 homolog A OS=Xenopus laevis GN=rmnd5a PE=2 SV=1 20 436 9.0E-52
sp|Q91YQ7|RMD5B_MOUSE Protein RMD5 homolog B OS=Mus musculus GN=Rmnd5b PE=2 SV=1 57 436 1.0E-50
sp|Q96G75|RMD5B_HUMAN Protein RMD5 homolog B OS=Homo sapiens GN=RMND5B PE=1 SV=1 57 436 4.0E-50
sp|Q640V2|RMD5A_XENTR Protein RMD5 homolog A OS=Xenopus tropicalis GN=rmnd5a PE=2 SV=1 57 436 4.0E-50
sp|O59668|YB83_SCHPO LisH domain-containing protein C29A3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.03c PE=3 SV=1 191 436 9.0E-47
sp|Q12508|RMD5_YEAST Sporulation protein RMD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD5 PE=3 SV=1 43 436 2.0E-28
sp|Q4VC33|MAEA_MOUSE Macrophage erythroblast attacher OS=Mus musculus GN=Maea PE=1 SV=1 201 434 4.0E-11
sp|Q5RKJ1|MAEA_RAT Macrophage erythroblast attacher OS=Rattus norvegicus GN=Maea PE=2 SV=2 201 434 4.0E-11
sp|Q5R532|MAEA_PONAB Macrophage erythroblast attacher OS=Pongo abelii GN=MAEA PE=2 SV=1 201 434 6.0E-11
sp|Q7L5Y9|MAEA_HUMAN Macrophage erythroblast attacher OS=Homo sapiens GN=MAEA PE=1 SV=1 201 434 6.0E-11
sp|Q4R9A8|MAEA_MACFA Macrophage erythroblast attacher OS=Macaca fascicularis GN=MAEA PE=2 SV=1 201 434 7.0E-11
sp|Q7SXR3|MAEA_DANRE Macrophage erythroblast attacher OS=Danio rerio GN=maea PE=2 SV=2 201 420 1.0E-09
sp|Q5F398|MAEA_CHICK Macrophage erythroblast attacher OS=Gallus gallus GN=MAEA PE=2 SV=1 201 420 1.0E-08
sp|Q6GR10|MAEA_XENLA Macrophage erythroblast attacher OS=Xenopus laevis GN=maea PE=2 SV=2 201 420 2.0E-08
sp|Q3MHJ2|MAEA_BOVIN Macrophage erythroblast attacher OS=Bos taurus GN=MAEA PE=2 SV=1 225 434 5.0E-08
sp|Q5AS80|FYV10_EMENI Protein fyv10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fyv10 PE=3 SV=2 209 340 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1924
MSGHDDEGSSPFAPLLAELARMRKSNLSAAIDDVDSIIDLLLKAREQVARDDDAHKIGMAMTTLQNPVKAQLEAI
TNDLKEVTKAQKSFGKALDKALPLRELPMETDAMADHPALINRAIAMHLLREGQFSVASTVLREEQEQRRHSESS
SADTTPSHTPDSDGDDDMMKPRETPNMDDMQSLSQDLQGRFSEMYDILAHLKRRNLAPAIEWAHVHNAPLDAKGS
NLEFDLCKLQFVWLFKGPSQNGLADDANNGQSGALAYARSHFSRFQSRHAKEIQQLCCAMLYAPNLAASPYKAMF
EIDSAFDDVATSFTREFCSLLGLSAESPLYMAVTAGSIALPRLIKYTTYTREKKTEWTTENELAFETPLPESMIF
HPIFVCPVSKEQTTVQNPAMMLTCGHVICRDSLHRIAKGSRYKCPYCPTEGHVRDALKISF*
Coding >Ophun1|1924
ATGTCCGGGCATGACGACGAGGGCTCCTCGCCCTTTGCGCCGCTGCTGGCTGAGCTGGCCCGCATGAGGAAGTCG
AATCTATCAGCCGCCATAGACGACGTCGATAGCATCATTGATCTACTCTTGAAGGCGAGGGAGCAGGTCGCTCGA
GATGACGACGCCCACAAGATCGGCATGGCCATGACGACGCTCCAGAACCCGGTCAAGGCACAGCTCGAAGCCATA
ACAAACGATCTCAAGGAGGTGACCAAGGCGCAGAAGAGTTTCGGCAAGGCCCTCGACAAGGCTCTCCCGCTCCGC
GAACTCCCAATGGAAACAGACGCAATGGCAGACCATCCCGCCCTCATCAACCGCGCCATCGCCATGCACCTCCTC
CGAGAAGGCCAATTCTCCGTCGCATCAACAGTCCTCCGAGAAGAACAAGAACAGCGACGACACAGCGAATCATCA
TCCGCAGACACAACCCCCTCCCACACCCCCGACTCAGACGGCGACGACGACATGATGAAACCGCGAGAAACCCCC
AACATGGACGACATGCAATCCCTCTCCCAAGACCTCCAAGGCCGCTTCTCCGAAATGTACGACATCCTCGCCCAC
CTCAAGCGCCGCAACCTCGCCCCAGCTATAGAATGGGCACACGTGCACAACGCCCCCCTCGACGCAAAAGGAAGC
AACCTAGAATTCGACCTCTGCAAGCTCCAATTCGTCTGGCTCTTCAAAGGCCCCTCACAAAACGGCCTCGCCGAC
GACGCAAACAACGGCCAAAGCGGCGCCCTAGCCTACGCGAGAAGCCACTTCTCCCGCTTCCAGTCCCGCCACGCA
AAGGAGATCCAACAGCTCTGCTGCGCCATGCTCTACGCCCCCAACCTCGCCGCCTCGCCCTACAAAGCAATGTTC
GAAATCGACTCGGCCTTTGACGACGTCGCCACCTCCTTCACCCGCGAGTTCTGCTCCCTCCTCGGCCTATCCGCC
GAATCGCCCCTCTACATGGCCGTCACAGCCGGCTCCATCGCCCTCCCCCGCCTCATCAAGTACACCACCTACACG
CGCGAGAAGAAGACGGAGTGGACGACGGAAAACGAACTCGCCTTCGAAACCCCCCTCCCCGAATCCATGATATTC
CACCCCATCTTCGTCTGCCCCGTCAGCAAGGAGCAGACAACGGTCCAGAACCCGGCCATGATGCTCACCTGCGGC
CACGTCATCTGCCGCGACAGCCTGCACAGGATCGCAAAGGGCTCGCGCTACAAGTGTCCCTACTGCCCGACAGAG
GGACACGTGCGGGACGCCCTCAAGATTTCATTCTGA
Transcript >Ophun1|1924
ATGTCCGGGCATGACGACGAGGGCTCCTCGCCCTTTGCGCCGCTGCTGGCTGAGCTGGCCCGCATGAGGAAGTCG
AATCTATCAGCCGCCATAGACGACGTCGATAGCATCATTGATCTACTCTTGAAGGCGAGGGAGCAGGTCGCTCGA
GATGACGACGCCCACAAGATCGGCATGGCCATGACGACGCTCCAGAACCCGGTCAAGGCACAGCTCGAAGCCATA
ACAAACGATCTCAAGGAGGTGACCAAGGCGCAGAAGAGTTTCGGCAAGGCCCTCGACAAGGCTCTCCCGCTCCGC
GAACTCCCAATGGAAACAGACGCAATGGCAGACCATCCCGCCCTCATCAACCGCGCCATCGCCATGCACCTCCTC
CGAGAAGGCCAATTCTCCGTCGCATCAACAGTCCTCCGAGAAGAACAAGAACAGCGACGACACAGCGAATCATCA
TCCGCAGACACAACCCCCTCCCACACCCCCGACTCAGACGGCGACGACGACATGATGAAACCGCGAGAAACCCCC
AACATGGACGACATGCAATCCCTCTCCCAAGACCTCCAAGGCCGCTTCTCCGAAATGTACGACATCCTCGCCCAC
CTCAAGCGCCGCAACCTCGCCCCAGCTATAGAATGGGCACACGTGCACAACGCCCCCCTCGACGCAAAAGGAAGC
AACCTAGAATTCGACCTCTGCAAGCTCCAATTCGTCTGGCTCTTCAAAGGCCCCTCACAAAACGGCCTCGCCGAC
GACGCAAACAACGGCCAAAGCGGCGCCCTAGCCTACGCGAGAAGCCACTTCTCCCGCTTCCAGTCCCGCCACGCA
AAGGAGATCCAACAGCTCTGCTGCGCCATGCTCTACGCCCCCAACCTCGCCGCCTCGCCCTACAAAGCAATGTTC
GAAATCGACTCGGCCTTTGACGACGTCGCCACCTCCTTCACCCGCGAGTTCTGCTCCCTCCTCGGCCTATCCGCC
GAATCGCCCCTCTACATGGCCGTCACAGCCGGCTCCATCGCCCTCCCCCGCCTCATCAAGTACACCACCTACACG
CGCGAGAAGAAGACGGAGTGGACGACGGAAAACGAACTCGCCTTCGAAACCCCCCTCCCCGAATCCATGATATTC
CACCCCATCTTCGTCTGCCCCGTCAGCAAGGAGCAGACAACGGTCCAGAACCCGGCCATGATGCTCACCTGCGGC
CACGTCATCTGCCGCGACAGCCTGCACAGGATCGCAAAGGGCTCGCGCTACAAGTGTCCCTACTGCCCGACAGAG
GGACACGTGCGGGACGCCCTCAAGATTTCATTCTGA
Gene >Ophun1|1924
ATGTCCGGGCATGACGACGAGGGCTCCTCGCCCTTTGCGCCGCTGCTGGCTGAGCTGGCCCGCATGAGGAAGTCG
AATCTATCAGCCGCCATAGACGACGTCGATAGCATCATTGATCTACTCTTGAAGGCGAGGGAGCAGGTCGCTCGA
GGTAAGCGCCTCACCTCGAGCGTGGCCATCGCGACGGCTTTCCTGACGGTTTGGCAGATGACGACGCCCACAAGA
TCGGCATGGCCATGACGACGCTCCAGAACCCGGTCAAGGCACAGCTCGAAGCCATAACAAACGATCTCAAGGAGG
TGACCAAGGCGCAGAAGAGTTTCGGCAAGGCCCTCGACAAGGTCCGTCACCTTCAACCCCCCGAATACCTCTCTA
ACACTCCCCCCCCCCTTAGGCTCTCCCGCTCCGCGAACTCCCAATGGAAACAGACGCAATGGCAGACCATCCCGC
CCTCATCAACCGCGCCATCGCCATGCACCTCCTCCGAGAAGGCCAATTCTCCGTCGCATCAACAGTCCTCCGAGA
AGAACAAGAACAGCGACGACACAGCGAATCATCATCCGCAGACACAACCCCCTCCCACACCCCCGACTCAGACGG
CGACGACGACATGATGAAACCGCGAGAAACCCCCAACATGGACGACATGCAATCCCTCTCCCAAGACCTCCAAGG
CCGCTTCTCCGAAATGTACGACATCCTCGCCCACCTCAAGCGCCGCAACCTCGCCCCAGCTATAGAATGGGCACA
CGTGCACAACGCCCCCCTCGACGCAAAAGGAAGCAACCTAGAATTCGACCTCTGCAAGCTCCAATTCGTCTGGCT
CTTCAAAGGCCCCTCACAAAACGGCCTCGCCGACGACGCAAACAACGGCCAAAGCGGCGCCCTAGCCTACGCGAG
AAGCCACTTCTCCCGCTTCCAGTCCCGCCACGCAAAGGAGATCCAACAGCTCTGCTGCGCCATGCTCTACGCCCC
CAACCTCGCCGCCTCGCCCTACAAAGCAATGTTCGAAATCGACTCGGCCTTTGACGACGTCGCCACCTCCTTCAC
CCGCGAGTTCTGCTCCCTCCTCGGCCTATCCGCCGAATCGCCCCTCTACATGGCCGTCACAGCCGGCTCCATCGC
CCTCCCCCGCCTCATCAAGTACACCACCTACACGCGCGAGAAGAAGACGGAGTGGACGACGGAAAACGAACTCGC
CTTCGAAACCCCCCTCCCCGAATCCATGATATTCCACCCCATCTTCGTCTGCCCCGTCAGCAAGGAGCAGACAAC
GGTCCAGAACCCGGCCATGATGCTCACCTGCGGCCACGTCATCTGCCGCGACAGCCTGCACAGGATCGCAAAGGG
CTCGCGCTACAAGTGTCCCTACTGCCCGACAGAGGGACACGTGCGGGACGCCCTCAAGATTTCATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail