Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|192
Gene name
LocationContig_1030:812..3404
Strand+
Gene length (bp)2592
Transcript length (bp)2469
Coding sequence length (bp)2469
Protein length (aa) 823

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08232 Striatin Striatin family 7.1E-42 32 169
PF00400 WD40 WD domain, G-beta repeat 8.9E-03 457 501
PF00400 WD40 WD domain, G-beta repeat 1.7E-03 509 560
PF00400 WD40 WD domain, G-beta repeat 9.6E-04 737 775
PF00400 WD40 WD domain, G-beta repeat 1.4E-04 780 820

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70M86|STRN_SORMK Striatin Pro11 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=pro11 PE=3 SV=1 13 822 0.0E+00
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 396 821 1.0E-32
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 396 821 2.0E-32
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 396 821 4.0E-32
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 396 821 6.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70M86|STRN_SORMK Striatin Pro11 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=pro11 PE=3 SV=1 13 822 0.0E+00
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 396 821 1.0E-32
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 396 821 2.0E-32
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 396 821 4.0E-32
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 396 821 6.0E-32
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 382 821 1.0E-28
sp|Q54J37|STRN_DICDI Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 393 820 2.0E-28
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 396 821 5.0E-28
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 721 821 8.0E-20
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 721 821 8.0E-20
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 721 821 9.0E-20
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 457 820 1.0E-18
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 397 820 1.0E-16
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 397 821 1.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 399 820 2.0E-15
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 389 820 1.0E-13
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 491 796 2.0E-13
sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 393 820 1.0E-11
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 471 820 1.0E-11
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 485 820 1.0E-11
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 469 820 2.0E-11
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 489 820 4.0E-11
sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 393 820 5.0E-11
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 491 820 8.0E-11
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 489 820 1.0E-10
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 471 820 1.0E-10
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 471 820 1.0E-10
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 471 820 1.0E-10
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 471 820 1.0E-10
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 471 820 2.0E-10
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 471 820 2.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 457 821 2.0E-10
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 489 789 2.0E-10
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 487 820 3.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 394 820 3.0E-10
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 511 820 4.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 489 820 4.0E-10
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 396 769 7.0E-10
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 471 820 7.0E-10
sp|Q05040|FAR8_YEAST Factor arrest protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR8 PE=1 SV=1 31 73 8.0E-10
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 491 788 9.0E-10
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 489 820 1.0E-09
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 459 822 1.0E-09
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 471 820 2.0E-09
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 489 820 2.0E-09
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 489 820 3.0E-09
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 471 820 3.0E-09
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 471 820 3.0E-09
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 720 820 4.0E-09
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 721 820 5.0E-09
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 721 820 5.0E-09
sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 30 98 6.0E-09
sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 30 98 6.0E-09
sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 30 98 6.0E-09
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 396 769 6.0E-09
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 720 820 6.0E-09
sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 30 98 7.0E-09
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 489 820 7.0E-09
sp|O94560|YGD1_SCHPO Uncharacterized WD repeat-containing protein C1773.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.01 PE=3 SV=1 31 112 8.0E-09
sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 30 98 9.0E-09
sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 30 98 1.0E-08
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 30 98 1.0E-08
sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 396 769 1.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 669 820 1.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 638 820 1.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 638 820 1.0E-08
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 457 820 1.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 629 820 2.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 638 820 2.0E-08
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 489 820 2.0E-08
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 489 820 2.0E-08
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 489 820 3.0E-08
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 489 820 3.0E-08
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 625 820 4.0E-08
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 625 820 4.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 720 821 5.0E-08
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 638 820 5.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 489 820 6.0E-08
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 720 820 8.0E-08
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 720 820 8.0E-08
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 720 820 8.0E-08
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 720 821 9.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 521 820 1.0E-07
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 471 820 1.0E-07
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 719 819 1.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 489 820 1.0E-07
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 719 819 1.0E-07
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 719 819 1.0E-07
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 717 820 1.0E-07
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 719 819 1.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 495 776 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 704 820 2.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 719 822 2.0E-07
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 719 819 2.0E-07
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 720 820 2.0E-07
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 720 820 2.0E-07
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 719 819 2.0E-07
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 719 819 2.0E-07
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 719 819 2.0E-07
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 719 819 2.0E-07
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 719 819 2.0E-07
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 720 820 2.0E-07
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 720 820 2.0E-07
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 720 820 2.0E-07
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 720 820 2.0E-07
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 489 788 3.0E-07
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 489 788 3.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 717 820 3.0E-07
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 487 822 3.0E-07
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 719 819 3.0E-07
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 487 822 3.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 717 820 3.0E-07
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 688 820 5.0E-07
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 720 820 5.0E-07
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 720 820 5.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 720 820 8.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 720 820 9.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 631 820 1.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 626 820 1.0E-06
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 720 820 1.0E-06
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 487 822 1.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 457 678 2.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 717 821 2.0E-06
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 703 820 2.0E-06
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 720 821 2.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 720 821 2.0E-06
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 720 820 2.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 720 800 3.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 603 820 3.0E-06
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 702 820 3.0E-06
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 702 820 3.0E-06
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 702 820 3.0E-06
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 702 820 3.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 720 820 3.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 703 820 3.0E-06
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 720 788 3.0E-06
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 486 801 3.0E-06
sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 31 110 4.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 603 820 4.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 702 820 4.0E-06
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 634 814 5.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 717 820 5.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 719 822 5.0E-06
sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 31 110 6.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 718 820 6.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 718 820 6.0E-06
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 720 820 6.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 720 821 7.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 719 822 8.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 720 820 9.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 720 822 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3187
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1226
Ophiocordyceps australis map64 (Brazil) OphauB2|3827
Ophiocordyceps camponoti-floridani Ophcf2|03714
Ophiocordyceps camponoti-rufipedis Ophun1|192 (this protein)
Ophiocordyceps kimflemingae Ophio5|3416
Ophiocordyceps subramaniannii Hirsu2|5719

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|192
MSPNAGNGMGPMDMGMAMHGNGANQPQATEYTLQGVMRFLQTEWHRHERDRNAWEIERQEMRSRIASLEGQARRA
DATQKALKKYVSILERKVKEQAAHVKMESPTAGTDRAARIQELLHTAKHSVPGADGGYVAQPADNAADDDAQRNE
LKSFLDQCQAEFMYLMVTPANPQPPRDSPPLPMMEDMRDVEAYAMPGPQHMDRQYRPSPNHAQDVNKSMGNRSQH
QATNAAPQMQLPLVPHAQGPADYQSQPMVRSASEHHQAPLYGGPGEWTAPVAVTTRAVDDDILGPLNSGETWAGI
DHSSDGRDKPPPAAPEPDGWEFPDATFSEPQQQAGPSTSHRPDTDVFPNADYLPKSPGRALSGHRRKSSLSRRRS
GENELPLGSSQRSEGGSFKLRFGLRGHLSTVRTVIFSGGGSPGEPEICTAGDDGMIKRFHIPRLDGSLGNAASDL
DVIANFTHRGHGGSVLALTSWSPSPNFSTGGRAQGDGWIFSGGQDSTIRVWERGRVDPKATLEGHTDAIWALCVL
PATLGSVFGSSSPYGSADRILLVSGAADSSVRLWSVSAPPQLSSPQPGTNRSMTGRGGRVRGNSMSSGSGFPSAP
QATVASNSPFHHTLVHVISRSDGSNASPTCITPLGGSGETFVVSYSDAAVVVYDTRTGEQVGQMDSMETSDGTKA
TSVNAVAATTSGLDQGGQHHGSNGDDAGGPTGGRSMAGSGVEGTIISGHEDRFVRFFDANSGQCTYNMLAHPDAI
SSLSLSPDGRELVSAGHDASLRFWSLEKRSCTQEITNHRVMRGEGICSCVWSQDGKWVVSGGGDGVVKVFAR*
Coding >Ophun1|192
ATGAGCCCGAATGCTGGCAACGGCATGGGGCCGATGGATATGGGCATGGCCATGCACGGCAACGGCGCCAACCAG
CCTCAGGCCACTGAGTATACTCTTCAGGGCGTTATGCGCTTCCTACAGACCGAGTGGCACCGTCATGAGCGCGAC
CGCAACGCGTGGGAGATTGAGCGCCAGGAGATGAGGAGCCGCATAGCCAGCCTCGAAGGCCAAGCGAGGAGAGCC
GACGCCACGCAGAAGGCACTGAAGAAATATGTGTCGATTCTCGAGCGCAAAGTCAAGGAACAGGCGGCTCACGTC
AAGATGGAATCACCCACTGCCGGCACCGACCGCGCTGCCAGGATTCAGGAGCTGCTTCACACCGCGAAGCATTCC
GTACCTGGTGCTGACGGCGGCTACGTCGCTCAGCCGGCTGACAATGCCGCCGACGACGACGCGCAGCGAAACGAG
CTCAAGTCGTTCCTTGATCAGTGCCAGGCCGAGTTCATGTATCTCATGGTGACGCCCGCCAACCCACAACCGCCT
CGCGACTCTCCGCCGCTACCCATGATGGAGGACATGCGCGACGTCGAGGCCTATGCCATGCCCGGTCCTCAACAC
ATGGACCGCCAGTACCGGCCGTCGCCCAACCACGCACAGGACGTCAACAAGTCGATGGGCAACCGGTCGCAGCAC
CAGGCCACCAACGCTGCTCCGCAGATGCAGCTACCTCTGGTCCCTCACGCCCAAGGCCCAGCGGACTATCAGTCA
CAACCCATGGTGCGGTCGGCCAGCGAACACCACCAAGCCCCGTTGTACGGCGGGCCCGGCGAGTGGACGGCGCCT
GTGGCGGTCACGACGCGCGCTGTTGATGATGACATCCTAGGGCCGTTGAACTCTGGCGAGACTTGGGCTGGCATA
GACCACTCTTCGGACGGGAGAGACAAGCCCCCCCCTGCGGCCCCCGAGCCCGACGGCTGGGAGTTTCCAGACGCC
ACCTTTTCCGAGCCCCAGCAGCAGGCCGGGCCGTCGACGTCGCATCGACCGGACACGGACGTCTTTCCCAACGCC
GATTACCTGCCCAAGTCGCCAGGTCGGGCCCTCAGCGGGCACCGCCGCAAGAGCTCCCTGTCGCGGCGGCGCAGC
GGCGAGAACGAGCTCCCGTTGGGCTCGAGCCAACGGTCCGAAGGCGGCAGCTTCAAACTTCGATTCGGCCTCCGA
GGCCACCTCAGCACGGTGCGGACAGTCATCTTCTCCGGGGGCGGCAGCCCGGGCGAGCCGGAGATTTGCACGGCG
GGCGACGACGGCATGATCAAGCGCTTTCACATCCCTCGGCTAGACGGGTCTCTGGGCAATGCGGCGTCGGACCTC
GACGTCATCGCCAACTTTACGCACCGCGGTCATGGGGGCTCTGTCCTGGCGCTGACGTCGTGGTCGCCGTCTCCC
AACTTTTCGACGGGCGGACGAGCACAGGGCGACGGCTGGATCTTTTCGGGCGGCCAGGACTCGACGATACGCGTC
TGGGAGCGAGGCCGAGTCGACCCCAAGGCTACGCTCGAGGGTCACACCGACGCCATTTGGGCGCTGTGCGTGCTT
CCCGCGACACTGGGATCCGTCTTTGGAAGCTCCAGCCCGTACGGCAGCGCGGACCGGATCCTGCTCGTCTCGGGC
GCAGCCGACTCATCGGTCCGGCTCTGGTCCGTCAGCGCGCCGCCGCAGCTGAGCTCGCCGCAGCCGGGTACCAAC
CGCAGCATGACGGGCCGCGGAGGCCGGGTGCGTGGCAACTCGATGAGCTCCGGCAGCGGGTTTCCCAGCGCGCCT
CAGGCTACGGTGGCGTCCAACTCGCCCTTTCACCACACGCTGGTGCACGTCATCTCGCGTTCGGACGGGTCCAAT
GCCAGCCCTACGTGCATCACGCCGCTGGGAGGGTCGGGCGAGACGTTTGTCGTCTCGTACTCGGACGCGGCCGTC
GTCGTCTACGACACGCGGACGGGTGAGCAGGTCGGCCAGATGGACAGCATGGAGACGTCGGACGGCACCAAGGCG
ACGAGCGTCAACGCCGTGGCGGCCACGACGAGCGGCCTGGACCAGGGAGGGCAGCATCACGGTAGCAACGGCGAC
GACGCGGGCGGGCCTACGGGAGGACGGTCCATGGCCGGCTCCGGCGTCGAAGGCACCATCATCTCCGGGCACGAG
GACCGGTTCGTGCGCTTCTTCGACGCCAACAGCGGGCAATGCACGTACAACATGCTGGCGCATCCAGACGCCATC
TCGAGCCTGTCTCTCAGTCCGGACGGGCGCGAGCTGGTGAGCGCAGGCCACGACGCGTCACTGCGCTTCTGGAGC
CTGGAGAAGCGGTCCTGCACGCAGGAGATTACGAATCACCGGGTCATGCGCGGCGAGGGCATCTGCTCCTGCGTC
TGGAGTCAGGACGGGAAATGGGTGGTGAGCGGCGGCGGCGACGGCGTCGTCAAGGTGTTTGCGCGGTAA
Transcript >Ophun1|192
ATGAGCCCGAATGCTGGCAACGGCATGGGGCCGATGGATATGGGCATGGCCATGCACGGCAACGGCGCCAACCAG
CCTCAGGCCACTGAGTATACTCTTCAGGGCGTTATGCGCTTCCTACAGACCGAGTGGCACCGTCATGAGCGCGAC
CGCAACGCGTGGGAGATTGAGCGCCAGGAGATGAGGAGCCGCATAGCCAGCCTCGAAGGCCAAGCGAGGAGAGCC
GACGCCACGCAGAAGGCACTGAAGAAATATGTGTCGATTCTCGAGCGCAAAGTCAAGGAACAGGCGGCTCACGTC
AAGATGGAATCACCCACTGCCGGCACCGACCGCGCTGCCAGGATTCAGGAGCTGCTTCACACCGCGAAGCATTCC
GTACCTGGTGCTGACGGCGGCTACGTCGCTCAGCCGGCTGACAATGCCGCCGACGACGACGCGCAGCGAAACGAG
CTCAAGTCGTTCCTTGATCAGTGCCAGGCCGAGTTCATGTATCTCATGGTGACGCCCGCCAACCCACAACCGCCT
CGCGACTCTCCGCCGCTACCCATGATGGAGGACATGCGCGACGTCGAGGCCTATGCCATGCCCGGTCCTCAACAC
ATGGACCGCCAGTACCGGCCGTCGCCCAACCACGCACAGGACGTCAACAAGTCGATGGGCAACCGGTCGCAGCAC
CAGGCCACCAACGCTGCTCCGCAGATGCAGCTACCTCTGGTCCCTCACGCCCAAGGCCCAGCGGACTATCAGTCA
CAACCCATGGTGCGGTCGGCCAGCGAACACCACCAAGCCCCGTTGTACGGCGGGCCCGGCGAGTGGACGGCGCCT
GTGGCGGTCACGACGCGCGCTGTTGATGATGACATCCTAGGGCCGTTGAACTCTGGCGAGACTTGGGCTGGCATA
GACCACTCTTCGGACGGGAGAGACAAGCCCCCCCCTGCGGCCCCCGAGCCCGACGGCTGGGAGTTTCCAGACGCC
ACCTTTTCCGAGCCCCAGCAGCAGGCCGGGCCGTCGACGTCGCATCGACCGGACACGGACGTCTTTCCCAACGCC
GATTACCTGCCCAAGTCGCCAGGTCGGGCCCTCAGCGGGCACCGCCGCAAGAGCTCCCTGTCGCGGCGGCGCAGC
GGCGAGAACGAGCTCCCGTTGGGCTCGAGCCAACGGTCCGAAGGCGGCAGCTTCAAACTTCGATTCGGCCTCCGA
GGCCACCTCAGCACGGTGCGGACAGTCATCTTCTCCGGGGGCGGCAGCCCGGGCGAGCCGGAGATTTGCACGGCG
GGCGACGACGGCATGATCAAGCGCTTTCACATCCCTCGGCTAGACGGGTCTCTGGGCAATGCGGCGTCGGACCTC
GACGTCATCGCCAACTTTACGCACCGCGGTCATGGGGGCTCTGTCCTGGCGCTGACGTCGTGGTCGCCGTCTCCC
AACTTTTCGACGGGCGGACGAGCACAGGGCGACGGCTGGATCTTTTCGGGCGGCCAGGACTCGACGATACGCGTC
TGGGAGCGAGGCCGAGTCGACCCCAAGGCTACGCTCGAGGGTCACACCGACGCCATTTGGGCGCTGTGCGTGCTT
CCCGCGACACTGGGATCCGTCTTTGGAAGCTCCAGCCCGTACGGCAGCGCGGACCGGATCCTGCTCGTCTCGGGC
GCAGCCGACTCATCGGTCCGGCTCTGGTCCGTCAGCGCGCCGCCGCAGCTGAGCTCGCCGCAGCCGGGTACCAAC
CGCAGCATGACGGGCCGCGGAGGCCGGGTGCGTGGCAACTCGATGAGCTCCGGCAGCGGGTTTCCCAGCGCGCCT
CAGGCTACGGTGGCGTCCAACTCGCCCTTTCACCACACGCTGGTGCACGTCATCTCGCGTTCGGACGGGTCCAAT
GCCAGCCCTACGTGCATCACGCCGCTGGGAGGGTCGGGCGAGACGTTTGTCGTCTCGTACTCGGACGCGGCCGTC
GTCGTCTACGACACGCGGACGGGTGAGCAGGTCGGCCAGATGGACAGCATGGAGACGTCGGACGGCACCAAGGCG
ACGAGCGTCAACGCCGTGGCGGCCACGACGAGCGGCCTGGACCAGGGAGGGCAGCATCACGGTAGCAACGGCGAC
GACGCGGGCGGGCCTACGGGAGGACGGTCCATGGCCGGCTCCGGCGTCGAAGGCACCATCATCTCCGGGCACGAG
GACCGGTTCGTGCGCTTCTTCGACGCCAACAGCGGGCAATGCACGTACAACATGCTGGCGCATCCAGACGCCATC
TCGAGCCTGTCTCTCAGTCCGGACGGGCGCGAGCTGGTGAGCGCAGGCCACGACGCGTCACTGCGCTTCTGGAGC
CTGGAGAAGCGGTCCTGCACGCAGGAGATTACGAATCACCGGGTCATGCGCGGCGAGGGCATCTGCTCCTGCGTC
TGGAGTCAGGACGGGAAATGGGTGGTGAGCGGCGGCGGCGACGGCGTCGTCAAGGTGTTTGCGCGGTAA
Gene >Ophun1|192
ATGAGCCCGAATGCTGGCAACGGCATGGGGCCGATGGATATGGGCATGGCCATGCACGGCAACGGCGCCAACCAG
CCTCAGGCCACTGAGTATACTCTTCAGGGCGTTATGCGCTTCCTACAGACCGAGTGGCACCGTCATGAGCGCGAC
CGCAACGCGTGGGAGATTGAGCGCCAGGAGATGAGGAGCCGCATAGCCAGCCTCGAAGGCCAAGCGAGGAGAGCC
GACGCCACGCAGAAGGCACTGAAGAAATATGTGTCGATTCTCGAGCGCAAAGTCAAGGAACAGGCGGCTCACGTC
AAGATGGAATCACCCACTGCCGGCACCGACCGCGCTGCCAGGATTCAGGAGCTGCTTCACAGTCGGTTCCCCCGC
CTGTCTCTTGATCCAAGCTGTATCGTGCCGCTGACATGGCTCTTGCAGCCGCGAAGCATTCCGTACCTGGTGCTG
ACGGCGGCTACGTCGCTCAGCCGGCTGACAATGCCGCCGACGACGACGCGCAGCGAAACGAGCTCAAGTCGTTCC
TTGATCAGTGCCAGGCCGAGTTCATGTATCTCATGGTGACGCCCGCCAACCCACAACCGCCTCGCGACTCTCCGC
CGCTACCCATGATGGAGGACATGCGCGACGTCGAGGCCTATGCCATGCCCGGTCCTCAACACATGGACCGCCAGT
ACCGGCCGTCGCCCAACCACGCACAGGACGTCAACAAGTCGATGGGCAACCGGTCGCAGCACCAGGCCACCAACG
CTGCTCCGCAGATGCAGCTACCTCTGGTCCCTCACGCCCAAGGCCCAGCGGACTATCAGTCACAACCCATGGTGC
GGTCGGCCAGCGAACACCACCAAGCCCCGTTGTACGGCGGGCCCGGCGAGTGGACGGCGCCTGTGGCGGTCACGA
CGCGCGCTGTTGATGATGACATCCTAGGGCCGTTGAACTCTGGCGAGACTTGGGCTGGCATAGACCACTCTTCGG
ACGGGAGAGACAAGCCCCCCCCTGCGGCCCCCGAGCCCGACGGCTGGGAGTTTCCAGACGCCACCTTTTCCGAGC
CCCAGCAGCAGGCCGGGCCGTCGACGTCGCATCGACCGGACACGGACGTCTTTCCCAACGCCGATTACCTGCCCA
AGTCGCCAGGTCGGGCCCTCAGCGGGCACCGCCGCAAGAGCTCCCTGTCGCGGCGGCGCAGCGGCGAGAACGAGC
TCCCGTTGGGCTCGAGCCAACGGTCCGAAGGCGGCAGCTTCAAACTTCGATTCGGCCTCCGAGGCCACCTCAGCA
CGGTGCGGACAGTCATCTTCTCCGGGGGCGGCAGCCCGGGCGAGCCGGAGATTTGCACGGCGGGCGACGACGGCA
TGATCAAGCGCTTTCACATCCCTCGGCTAGACGGGTCTCTGGGCAATGCGGCGTCGGACCTCGACGTCATCGCCA
ACTTTACGCACCGCGGTCATGGGGGCTCTGTCCTGGCGCTGACGTCGTGGTCGCCGTCTCCCAACTTTTCGACGG
GCGGACGAGCACAGGGCGACGGCTGGATCTTTTCGGGCGGCCAGGACTCGACGATACGCGTCTGGGAGCGAGGCC
GAGTCGACCCCAAGGCTACGCTCGAGGGTCACACCGACGCCATTTGGGCGCTGTGCGTGCTTCCCGCGACACTGG
GATCCGTCTTTGGAAGCTCCAGCCCGTACGGCAGCGCGGACCGGATCCTGCTCGTCTCGGGCGCAGCCGACTCAT
CGGTCCGGCTCTGGTCCGTCAGCGCGCCGCCGCAGCTGAGCTCGCCGCAGCCGGGTACCAACCGCAGCATGACGG
GCCGCGGAGGCCGGGTGCGTGGCAACTCGATGAGCTCCGGCAGCGGGTTTCCCAGCGCGCCTCAGGCTACGGTGG
CGTCCAACTCGCCCTTTCACCACACGCTGGTGCACGTCATCTCGCGTTCGGACGGGTCCAATGCCAGCCCTACGT
GCATCACGCCGCTGGGAGGGTCGGGCGAGACGTTTGTCGTCTCGTACTCGGACGCGGCCGTCGTCGTCTACGACA
CGCGGACGGGTGAGCAGGTCGGCCAGATGGACAGCATGGAGACGTCGGACGGCACCAAGGCGACGAGCGTCAACG
CCGTGGCGGCCACGACGAGCGGCCTGGACCAGGGAGGGCAGCATCACGGTAGCAACGGCGACGACGCGGGCGGGC
CTACGGGAGGACGGTCCATGGCCGGCTCCGGCGTCGAAGGCACCATCATCTCCGGGCACGAGGACCGGTTCGTGC
GCTTCTTCGACGCCAACAGCGGTAAGTCTATCCGTACACGACAGCCAACCATGGAGACGGGTAGCTGACGAGTCG
ATGGCAGGGCAATGCACGTACAACATGCTGGCGCATCCAGACGCCATCTCGAGCCTGTCTCTCAGTCCGGACGGG
CGCGAGCTGGTGAGCGCAGGCCACGACGCGTCACTGCGCTTCTGGAGCCTGGAGAAGCGGTCCTGCACGCAGGAG
ATTACGAATCACCGGGTCATGCGCGGCGAGGGCATCTGCTCCTGCGTCTGGAGTCAGGACGGGAAATGGGTGGTG
AGCGGCGGCGGCGACGGCGTCGTCAAGGTGTTTGCGCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail