Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1919
Gene name
LocationContig_187:14860..15199
Strand+
Gene length (bp)339
Transcript length (bp)282
Coding sequence length (bp)282
Protein length (aa) 94

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger 4.3E-18 17 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPZ1|TIM10_GIBZE Mitochondrial import inner membrane translocase subunit TIM10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM10 PE=3 SV=1 2 76 2.0E-37
sp|Q4WJX5|TIM10_ASPFU Mitochondrial import inner membrane translocase subunit tim10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim10 PE=3 SV=1 1 85 1.0E-27
sp|Q9C0N3|TIM10_NEUCR Mitochondrial import inner membrane translocase subunit tim10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim10 PE=1 SV=1 1 89 1.0E-24
sp|Q9Y8A8|TIM10_EMENI Mitochondrial import inner membrane translocase subunit tim10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim10 PE=3 SV=1 1 76 2.0E-24
sp|Q759W7|TIM10_ASHGO Mitochondrial import inner membrane translocase subunit TIM10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM10 PE=3 SV=1 1 78 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPZ1|TIM10_GIBZE Mitochondrial import inner membrane translocase subunit TIM10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM10 PE=3 SV=1 2 76 2.0E-37
sp|Q4WJX5|TIM10_ASPFU Mitochondrial import inner membrane translocase subunit tim10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim10 PE=3 SV=1 1 85 1.0E-27
sp|Q9C0N3|TIM10_NEUCR Mitochondrial import inner membrane translocase subunit tim10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim10 PE=1 SV=1 1 89 1.0E-24
sp|Q9Y8A8|TIM10_EMENI Mitochondrial import inner membrane translocase subunit tim10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim10 PE=3 SV=1 1 76 2.0E-24
sp|Q759W7|TIM10_ASHGO Mitochondrial import inner membrane translocase subunit TIM10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM10 PE=3 SV=1 1 78 1.0E-20
sp|Q6DI06|TIM10_DANRE Mitochondrial import inner membrane translocase subunit Tim10 OS=Danio rerio GN=timm10 PE=3 SV=1 8 89 7.0E-20
sp|P87108|TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM10 PE=1 SV=1 2 87 8.0E-20
sp|Q6GQ52|TI10B_XENLA Mitochondrial import inner membrane translocase subunit Tim10-B OS=Xenopus laevis GN=timm10-b PE=3 SV=1 8 81 1.0E-19
sp|Q6P321|TIM10_XENTR Mitochondrial import inner membrane translocase subunit Tim10 OS=Xenopus tropicalis GN=timm10 PE=3 SV=1 8 81 2.0E-19
sp|Q2NKR1|TIM10_BOVIN Mitochondrial import inner membrane translocase subunit Tim10 OS=Bos taurus GN=TIMM10 PE=3 SV=1 8 72 4.0E-19
sp|P62072|TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens GN=TIMM10 PE=1 SV=1 8 72 4.0E-19
sp|P62073|TIM10_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 OS=Mus musculus GN=Timm10 PE=1 SV=1 8 72 4.0E-19
sp|P62074|TIM10_RAT Mitochondrial import inner membrane translocase subunit Tim10 OS=Rattus norvegicus GN=Timm10 PE=3 SV=1 8 72 4.0E-19
sp|Q9UTE9|TIM10_SCHPO Mitochondrial import inner membrane translocase subunit tim10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim10 PE=3 SV=1 1 83 4.0E-19
sp|Q6CIK7|TIM10_KLULA Mitochondrial import inner membrane translocase subunit TIM10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM10 PE=3 SV=1 1 78 1.0E-18
sp|Q4QR62|TI10A_XENLA Mitochondrial import inner membrane translocase subunit Tim10-A OS=Xenopus laevis GN=timm10-a PE=3 SV=1 8 81 1.0E-17
sp|Q9Y0V6|TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans GN=tin-10 PE=3 SV=1 6 68 6.0E-17
sp|Q6C6U1|TIM10_YARLI Mitochondrial import inner membrane translocase subunit TIM10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM10 PE=3 SV=1 1 75 1.0E-16
sp|Q6BHJ3|TIM10_DEBHA Mitochondrial import inner membrane translocase subunit TIM10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM10 PE=3 SV=1 1 84 3.0E-16
sp|Q9P335|TIM10_PICSO Mitochondrial import inner membrane translocase subunit Tim10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=TIM10 PE=3 SV=1 1 84 4.0E-16
sp|Q61BP6|TIM10_CAEBR Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis briggsae GN=tin-10 PE=3 SV=1 6 68 5.0E-16
sp|Q9W2D6|TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster GN=Tim10 PE=3 SV=1 19 72 7.0E-16
sp|P0CR98|TIM10_CRYNJ Mitochondrial import inner membrane translocase subunit TIM10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM10 PE=3 SV=1 1 88 4.0E-14
sp|P0CR99|TIM10_CRYNB Mitochondrial import inner membrane translocase subunit TIM10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM10 PE=3 SV=1 1 88 4.0E-14
sp|Q9ZW33|TIM10_ARATH Mitochondrial import inner membrane translocase subunit TIM10 OS=Arabidopsis thaliana GN=TIM10 PE=1 SV=1 13 76 5.0E-10
sp|Q54NZ0|TIM10_DICDI Mitochondrial import inner membrane translocase subunit Tim10 OS=Dictyostelium discoideum GN=timm10 PE=3 SV=1 21 76 7.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5660
Ophiocordyceps australis map64 (Brazil) OphauB2|1307
Ophiocordyceps camponoti-floridani Ophcf2|02339
Ophiocordyceps camponoti-rufipedis Ophun1|1919 (this protein)
Ophiocordyceps kimflemingae Ophio5|1707
Ophiocordyceps subramaniannii Hirsu2|10941

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1919
MFGIGSTDSNASQRVAAIESEMRLMADTYNRLQKSCQQKCVPTDYREAELNKGESVCLDRCTAKFLDTSLRVSEI
MQQQQQQGQGGGAGPSSF*
Coding >Ophun1|1919
ATGTTCGGCATCGGAAGCACAGACTCCAACGCGTCGCAAAGGGTCGCCGCCATTGAGAGCGAGATGCGTCTCATG
GCCGATACCTACAACCGGCTGCAGAAATCATGCCAGCAGAAGTGCGTGCCGACGGACTACCGCGAGGCGGAGCTC
AACAAGGGCGAATCCGTCTGTCTTGATCGCTGCACGGCAAAGTTTCTCGATACGTCGCTTAGGGTCAGTGAGATT
ATGCAGCAGCAGCAGCAGCAGGGACAGGGCGGTGGCGCTGGGCCCAGTTCCTTCTGA
Transcript >Ophun1|1919
ATGTTCGGCATCGGAAGCACAGACTCCAACGCGTCGCAAAGGGTCGCCGCCATTGAGAGCGAGATGCGTCTCATG
GCCGATACCTACAACCGGCTGCAGAAATCATGCCAGCAGAAGTGCGTGCCGACGGACTACCGCGAGGCGGAGCTC
AACAAGGGCGAATCCGTCTGTCTTGATCGCTGCACGGCAAAGTTTCTCGATACGTCGCTTAGGGTCAGTGAGATT
ATGCAGCAGCAGCAGCAGCAGGGACAGGGCGGTGGCGCTGGGCCCAGTTCCTTCTGA
Gene >Ophun1|1919
ATGTTCGGCATCGGAAGCACAGACTCCAACGCGTCGCAAAGGGTCGCCGCCATTGAGAGCGAGATGCGTCTCATG
GCCGATACCTACAACCGGTACGGGCGTCTTCATTCGCCGCTGTATCCCCCAGCCAGCTGATGTGTGCGTCCCAGG
CTGCAGAAATCATGCCAGCAGAAGTGCGTGCCGACGGACTACCGCGAGGCGGAGCTCAACAAGGGCGAATCCGTC
TGTCTTGATCGCTGCACGGCAAAGTTTCTCGATACGTCGCTTAGGGTCAGTGAGATTATGCAGCAGCAGCAGCAG
CAGGGACAGGGCGGTGGCGCTGGGCCCAGTTCCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail