Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1910
Gene name
LocationContig_186:23822..24366
Strand-
Gene length (bp)544
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02391 MoaE MoaE protein 2.7E-39 20 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2KF83|MOC2B_MAGO7 Molybdopterin synthase catalytic subunit OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cnxH PE=3 SV=1 6 160 6.0E-81
sp|Q7SEW2|MOC2B_NEUCR Molybdopterin synthase catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-8 PE=3 SV=1 10 160 6.0E-71
sp|A7EVF4|MOC2B_SCLS1 Molybdopterin synthase catalytic subunit OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cnxH PE=3 SV=1 10 160 1.0E-67
sp|B2WBW4|MOC2B_PYRTR Molybdopterin synthase catalytic subunit OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cnxH PE=3 SV=1 17 160 1.0E-52
sp|Q0V713|MOC2B_PHANO Molybdopterin synthase catalytic subunit OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=cnxH PE=3 SV=2 17 160 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2KF83|MOC2B_MAGO7 Molybdopterin synthase catalytic subunit OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cnxH PE=3 SV=1 6 160 6.0E-81
sp|Q7SEW2|MOC2B_NEUCR Molybdopterin synthase catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-8 PE=3 SV=1 10 160 6.0E-71
sp|A7EVF4|MOC2B_SCLS1 Molybdopterin synthase catalytic subunit OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cnxH PE=3 SV=1 10 160 1.0E-67
sp|B2WBW4|MOC2B_PYRTR Molybdopterin synthase catalytic subunit OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cnxH PE=3 SV=1 17 160 1.0E-52
sp|Q0V713|MOC2B_PHANO Molybdopterin synthase catalytic subunit OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=cnxH PE=3 SV=2 17 160 2.0E-52
sp|Q1DQS9|MOC2B_COCIM Molybdopterin synthase catalytic subunit OS=Coccidioides immitis (strain RS) GN=cnxH PE=3 SV=2 17 153 2.0E-50
sp|A2QF55|MOC2B_ASPNC Molybdopterin synthase catalytic subunit OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cnxH PE=3 SV=1 15 161 8.0E-48
sp|Q2U4W2|MOC2B_ASPOR Molybdopterin synthase catalytic subunit OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cnxH PE=3 SV=1 17 163 2.0E-45
sp|A1CJM9|MOC2B_ASPCL Molybdopterin synthase catalytic subunit OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cnxH PE=3 SV=1 14 161 7.0E-42
sp|A6R104|MOC2B_AJECN Molybdopterin synthase catalytic subunit OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=cnxH PE=3 SV=2 11 153 2.0E-39
sp|Q9Y8C1|MOC2B_EMENI Molybdopterin synthase catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnxH PE=1 SV=1 17 153 2.0E-37
sp|Q171H3|MO2B1_AEDAE Molybdopterin synthase catalytic subunit 1 OS=Aedes aegypti GN=Mocs2-1 PE=3 SV=1 16 155 4.0E-37
sp|Q1DGL6|MO2B2_AEDAE Molybdopterin synthase catalytic subunit 2 OS=Aedes aegypti GN=Mocs2-2 PE=3 SV=1 16 155 5.0E-37
sp|B0X1V5|MOC2B_CULQU Molybdopterin synthase catalytic subunit OS=Culex quinquefasciatus GN=Mocs2 PE=3 SV=2 15 153 3.0E-35
sp|Q7QAD7|MOC2B_ANOGA Molybdopterin synthase catalytic subunit OS=Anopheles gambiae GN=Mocs2 PE=3 SV=4 16 163 6.0E-35
sp|A1D7X4|MOC2B_NEOFI Molybdopterin synthase catalytic subunit OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cnxH PE=3 SV=1 14 163 8.0E-35
sp|Q4WWW9|MOC2B_ASPFU Molybdopterin synthase catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnxH PE=3 SV=1 14 163 8.0E-35
sp|B0XYQ4|MOC2B_ASPFC Molybdopterin synthase catalytic subunit OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cnxH PE=3 SV=1 14 163 8.0E-35
sp|Q9Z223|MOC2B_MOUSE Molybdopterin synthase catalytic subunit OS=Mus musculus GN=Mocs2 PE=1 SV=3 18 153 2.0E-33
sp|A4FUY7|MOC2B_BOVIN Molybdopterin synthase catalytic subunit OS=Bos taurus GN=MOCS2 PE=2 SV=2 6 153 6.0E-33
sp|Q6AY59|MOC2B_RAT Molybdopterin synthase catalytic subunit OS=Rattus norvegicus GN=Mocs2 PE=2 SV=1 18 153 7.0E-33
sp|O96007|MOC2B_HUMAN Molybdopterin synthase catalytic subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1 18 153 1.0E-32
sp|B5FXU9|MOC2B_TAEGU Molybdopterin synthase catalytic subunit OS=Taeniopygia guttata GN=MOCS2 PE=2 SV=1 17 153 7.0E-32
sp|B4QUC0|MOC2B_DROSI Molybdopterin synthase catalytic subunit OS=Drosophila simulans GN=Mocs2 PE=3 SV=1 17 154 3.0E-31
sp|B4PUD1|MOC2B_DROYA Molybdopterin synthase catalytic subunit OS=Drosophila yakuba GN=Mocs2 PE=3 SV=1 17 154 1.0E-30
sp|Q9VBX2|MOC2B_DROME Molybdopterin synthase catalytic subunit OS=Drosophila melanogaster GN=Mocs2 PE=2 SV=2 17 154 2.0E-30
sp|B4IJG7|MOC2B_DROSE Molybdopterin synthase catalytic subunit OS=Drosophila sechellia GN=Mocs2 PE=3 SV=1 17 154 4.0E-30
sp|Q6Z2X3|MOC2B_ORYSJ Molybdopterin synthase catalytic subunit OS=Oryza sativa subsp. japonica GN=MOCS2 PE=2 SV=1 2 153 5.0E-30
sp|A2X0R4|MOC2B_ORYSI Molybdopterin synthase catalytic subunit OS=Oryza sativa subsp. indica GN=MOCS2 PE=3 SV=1 2 153 5.0E-30
sp|B4LVP8|MOC2B_DROVI Molybdopterin synthase catalytic subunit OS=Drosophila virilis GN=Mocs2 PE=3 SV=1 17 151 1.0E-29
sp|B4GE20|MOC2B_DROPE Molybdopterin synthase catalytic subunit OS=Drosophila persimilis GN=Mocs2 PE=3 SV=1 16 163 1.0E-29
sp|B3P6R5|MOC2B_DROER Molybdopterin synthase catalytic subunit OS=Drosophila erecta GN=Mocs2 PE=3 SV=1 17 159 1.0E-29
sp|B4JHP4|MOC2B_DROGR Molybdopterin synthase catalytic subunit OS=Drosophila grimshawi GN=Mocs2 PE=3 SV=1 17 151 2.0E-29
sp|Q297G3|MOC2B_DROPS Molybdopterin synthase catalytic subunit OS=Drosophila pseudoobscura pseudoobscura GN=Mocs2 PE=3 SV=2 16 163 2.0E-29
sp|B4NJW0|MOC2B_DROWI Molybdopterin synthase catalytic subunit OS=Drosophila willistoni GN=Mocs2 PE=3 SV=1 17 154 2.0E-29
sp|B3M268|MOC2B_DROAN Molybdopterin synthase catalytic subunit OS=Drosophila ananassae GN=Mocs2 PE=3 SV=1 17 163 3.0E-29
sp|B4KBH3|MOC2B_DROMO Molybdopterin synthase catalytic subunit OS=Drosophila mojavensis GN=Mocs2 PE=3 SV=1 17 151 3.0E-29
sp|O22827|MOC2B_ARATH Molybdopterin synthase catalytic subunit OS=Arabidopsis thaliana GN=MOCS2 PE=2 SV=1 1 153 3.0E-29
sp|Q97CL5|MOAE_THEVO Molybdopterin synthase catalytic subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=moaE PE=3 SV=1 15 148 2.0E-24
sp|Q86HF4|MOC2B_DICDI Molybdopterin synthase catalytic subunit OS=Dictyostelium discoideum GN=mocs2l PE=3 SV=1 17 151 2.0E-23
sp|P9WJR3|MOAE1_MYCTU Molybdopterin synthase catalytic subunit 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaE1 PE=1 SV=1 13 152 3.0E-22
sp|Q5RA61|MOC2B_PONAB Molybdopterin synthase catalytic subunit OS=Pongo abelii GN=MOCS2 PE=2 SV=2 18 153 3.0E-22
sp|P9WJR2|MOAE1_MYCTO Molybdopterin synthase catalytic subunit 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaE1 PE=3 SV=1 13 152 3.0E-22
sp|O31705|MOAE_BACSU Molybdopterin synthase catalytic subunit OS=Bacillus subtilis (strain 168) GN=moaE PE=3 SV=1 19 145 4.0E-21
sp|Q9K8I7|MOAE_BACHD Molybdopterin synthase catalytic subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=moaE PE=3 SV=1 19 145 1.0E-19
sp|Q8YWH5|MOAE_NOSS1 Molybdopterin synthase catalytic subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moaE PE=3 SV=1 40 148 3.0E-19
sp|Q6GEG3|MOAE_STAAR Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain MRSA252) GN=moaE PE=3 SV=1 40 154 2.0E-17
sp|Q5HDT6|MOAE_STAAC Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain COL) GN=moaE PE=3 SV=1 40 154 2.0E-17
sp|Q6G751|MOAE_STAAS Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain MSSA476) GN=moaE PE=3 SV=1 40 154 2.0E-17
sp|Q8NVA3|MOAE_STAAW Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain MW2) GN=moaE PE=3 SV=1 40 154 2.0E-17
sp|P65400|MOAE_STAAM Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moaE PE=3 SV=1 40 154 2.0E-17
sp|P65401|MOAE_STAAN Molybdopterin synthase catalytic subunit OS=Staphylococcus aureus (strain N315) GN=moaE PE=1 SV=1 40 154 2.0E-17
sp|Q9V2A7|MOAE_PYRAB Molybdopterin synthase catalytic subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=moaE PE=3 SV=1 16 139 5.0E-17
sp|Q9ZIM9|MOAE_STACT Molybdopterin synthase catalytic subunit OS=Staphylococcus carnosus (strain TM300) GN=moaE PE=3 SV=1 32 144 6.0E-17
sp|Q55371|Y903_SYNY3 Uncharacterized protein slr0903 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0903 PE=4 SV=1 20 148 2.0E-16
sp|O67928|MOAE_AQUAE Molybdopterin synthase catalytic subunit OS=Aquifex aeolicus (strain VF5) GN=moaE PE=1 SV=1 18 158 3.0E-16
sp|Q8CNE3|MOAE_STAES Molybdopterin synthase catalytic subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaE PE=3 SV=1 40 158 1.0E-15
sp|Q5HLX8|MOAE_STAEQ Molybdopterin synthase catalytic subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaE PE=3 SV=1 40 158 1.0E-15
sp|Q9KT77|MOAE_VIBCH Molybdopterin synthase catalytic subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=moaE PE=3 SV=1 18 139 2.0E-15
sp|Q8ZGW2|MOAE_YERPE Molybdopterin synthase catalytic subunit OS=Yersinia pestis GN=moaE PE=3 SV=1 38 154 1.0E-14
sp|P30749|MOAE_ECOLI Molybdopterin synthase catalytic subunit OS=Escherichia coli (strain K12) GN=moaE PE=1 SV=3 38 145 1.0E-14
sp|P65398|MOAE_SALTY Molybdopterin synthase catalytic subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moaE PE=3 SV=1 38 153 4.0E-14
sp|P65399|MOAE_SALTI Molybdopterin synthase catalytic subunit OS=Salmonella typhi GN=moaE PE=3 SV=1 38 153 4.0E-14
sp|Q92QX5|MOAE_RHIME Molybdopterin synthase catalytic subunit OS=Rhizobium meliloti (strain 1021) GN=moaE PE=3 SV=1 18 146 1.0E-12
sp|Q9CN24|MOAE_PASMU Molybdopterin synthase catalytic subunit OS=Pasteurella multocida (strain Pm70) GN=moaE PE=3 SV=1 40 153 1.0E-12
sp|Q7VLN4|MOAE_HAEDU Molybdopterin synthase catalytic subunit OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=moaE PE=3 SV=1 40 158 2.0E-12
sp|P45308|MOAE_HAEIN Molybdopterin synthase catalytic subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moaE PE=3 SV=1 40 145 2.0E-12
sp|D4GSW7|MOAE_HALVD Probable molybdopterin synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=moaE PE=1 SV=1 24 139 5.0E-12
sp|P65397|MOAE_BRUSU Molybdopterin synthase catalytic subunit OS=Brucella suis biovar 1 (strain 1330) GN=moaE PE=3 SV=1 18 147 7.0E-12
sp|P65396|MOAE_BRUME Molybdopterin synthase catalytic subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=moaE PE=3 SV=1 18 147 7.0E-12
sp|P9WJR1|MOAE2_MYCTU Molybdopterin synthase catalytic subunit 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaE2 PE=1 SV=1 19 148 1.0E-11
sp|P9WJR0|MOAE2_MYCTO Molybdopterin synthase catalytic subunit 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaE2 PE=3 SV=1 19 148 1.0E-11
sp|Q8XZR3|MOAE_RALSO Molybdopterin synthase catalytic subunit OS=Ralstonia solanacearum (strain GMI1000) GN=moaE PE=3 SV=1 25 144 6.0E-11
sp|Q56210|MOAE_SYNE7 Molybdopterin synthase catalytic subunit OS=Synechococcus elongatus (strain PCC 7942) GN=moaE PE=3 SV=1 18 148 3.0E-10
sp|Q984P0|MOAE_RHILO Molybdopterin synthase catalytic subunit OS=Rhizobium loti (strain MAFF303099) GN=moaE PE=3 SV=1 38 148 3.0E-10
sp|Q9AC50|MOAE_CAUCR Molybdopterin synthase catalytic subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=moaE PE=3 SV=1 18 146 1.0E-09
sp|Q9HX97|MOAE_PSEAE Molybdopterin synthase catalytic subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=moaE PE=3 SV=1 40 159 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Yes
GO:0043545 molybdopterin cofactor metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019720 Mo-molybdopterin cofactor metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0051189 prosthetic group metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3972
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4437
Ophiocordyceps australis map64 (Brazil) OphauB2|5107
Ophiocordyceps camponoti-floridani Ophcf2|00793
Ophiocordyceps camponoti-rufipedis Ophun1|1910 (this protein)
Ophiocordyceps kimflemingae Ophio5|6137
Ophiocordyceps subramaniannii Hirsu2|7936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1910
MAGSENEIWELSGHGSYVSLTNDHLSIGAVMDRVRSPEAGAIVLFAGTTRDNFAGKPVKELQYTAYNGLALRTML
AICDDIRSRHGLKGIAMVHRLGTVPIGEESILIAVSAPHRQAAWRAGEEALEACKAKVEVWKREEFHGGDGVWRA
NRDGAAGQRVVDS*
Coding >Ophun1|1910
ATGGCCGGCTCCGAGAATGAGATTTGGGAATTATCCGGACATGGAAGCTATGTCTCTCTGACAAACGATCATCTC
AGCATCGGGGCTGTCATGGACAGAGTTCGCAGCCCTGAAGCCGGTGCCATTGTCCTCTTCGCCGGCACGACACGC
GACAACTTCGCCGGCAAGCCCGTCAAGGAACTGCAGTACACGGCATACAACGGACTCGCGTTACGAACGATGCTG
GCCATATGCGACGACATCCGGAGCAGACACGGTCTCAAGGGCATCGCCATGGTCCACCGCCTGGGCACGGTTCCC
ATCGGCGAGGAGAGCATACTGATTGCTGTTTCTGCGCCGCACAGGCAGGCCGCGTGGAGGGCGGGCGAGGAGGCT
CTCGAGGCGTGCAAGGCAAAGGTCGAGGTGTGGAAGCGCGAGGAGTTTCATGGCGGAGACGGCGTCTGGCGTGCA
AACCGGGATGGAGCTGCAGGTCAACGTGTTGTCGACTCTTGA
Transcript >Ophun1|1910
ATGGCCGGCTCCGAGAATGAGATTTGGGAATTATCCGGACATGGAAGCTATGTCTCTCTGACAAACGATCATCTC
AGCATCGGGGCTGTCATGGACAGAGTTCGCAGCCCTGAAGCCGGTGCCATTGTCCTCTTCGCCGGCACGACACGC
GACAACTTCGCCGGCAAGCCCGTCAAGGAACTGCAGTACACGGCATACAACGGACTCGCGTTACGAACGATGCTG
GCCATATGCGACGACATCCGGAGCAGACACGGTCTCAAGGGCATCGCCATGGTCCACCGCCTGGGCACGGTTCCC
ATCGGCGAGGAGAGCATACTGATTGCTGTTTCTGCGCCGCACAGGCAGGCCGCGTGGAGGGCGGGCGAGGAGGCT
CTCGAGGCGTGCAAGGCAAAGGTCGAGGTGTGGAAGCGCGAGGAGTTTCATGGCGGAGACGGCGTCTGGCGTGCA
AACCGGGATGGAGCTGCAGGTCAACGTGTTGTCGACTCTTGA
Gene >Ophun1|1910
ATGGCCGGCTCCGAGAATGAGATTTGGGAATTATCCGGACATGGAAGCTATGTCTCTCTGACAAACGATCATCTC
AGCATCGGGGCTGTCATGGACAGAGTTCGCAGCCCTGAAGCCGGTGCCATTGTCCTCTTCGCCGGTGAGCCTGAC
CTCTCTGATTGATGACTCTACGTGCTCATACGCAGCCTCAGGCACGACACGCGACAACTTCGCCGGCAAGCCCGT
CAAGGAACTGCAGTACACGGCATACAACGGACTCGCGTTACGAACGATGCTGGCCATATGCGACGACATCCGGAG
CAGACACGGTCTCAAGGGCATCGCCATGGTCCACCGCCTGGGCACGGTTCCCATCGGCGAGGAGAGCATACTGAT
TGCTGTTTCTGCGCCGCACAGGCAGGCCGCGTGGAGGGCGGGCGAGGAGGCTCTCGAGGCGTGCAAGGCAAAGGT
CGAGGTGTGGAAGCGCGAGGAGTTTCATGGCGGAGACGGCGTCTGGCGTGCAAACCGGGATGGAGCTGCAGGTCA
ACGTGTTGTCGACTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail