Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1900
Gene name
LocationContig_185:27379..29041
Strand+
Gene length (bp)1662
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08386 Abhydrolase_4 TAP-like protein 2.5E-22 418 516
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.4E-15 86 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 46 516 3.0E-34
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 46 516 2.0E-33
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 30 516 3.0E-22
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 30 516 3.0E-22
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 30 516 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 46 516 3.0E-34
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 46 516 2.0E-33
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 30 516 3.0E-22
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 30 516 3.0E-22
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 30 516 3.0E-22
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 34 516 8.0E-21
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 34 516 8.0E-21
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 34 516 8.0E-21
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999701

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup311
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06182
Ophiocordyceps camponoti-floridani Ophcf2|07091
Ophiocordyceps camponoti-rufipedis Ophun1|1900 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4720
Ophiocordyceps kimflemingae Ophio5|2000
Ophiocordyceps kimflemingae Ophio5|3563
Ophiocordyceps subramaniannii Hirsu2|1396
Ophiocordyceps subramaniannii Hirsu2|8128
Ophiocordyceps subramaniannii Hirsu2|9559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1900
MRSLFLYLAASSVFHATAYSADEKPNKYPGENISWTPCGNTTQGTPLECSNITVPADQFAPKNQTSDLKFKIPLI
RLRSKNGTKNLLFNPGGPGGSGVGAIRENGDALFNATGGDHHILSFDPRGVKGSDPQAACSSLSRPDPETPFAVR
NPKLYAWATSYTKSCADIMGEHGKFINTPQTAADMNSIIDAVGQSDMYFLGVSYGSVLGQTYASLFPKRSARIII
DSNIHLKEYYESNVDTSTFDYTHEVWEGFIRECFKAGSRCALTPRARSEKELLDKVTSFIDGLGPAPMSIYVNAT
TNGFLTAYEVWFEIQQALYRPDSWRSTAAILNDMMDGNGTEALLAWKKGADEEEDEEDKVDADDDTKNMTKPAST
EESSRLVITANDRPSGPANWTQGLDSLVKVLTPSFNKSAPWYETWNHDYFILQQWPINKTHPFQVTKNVNTAFPM
LILQNRFDPVTPLVAAQFASQTFNDSRLVVVDGYGHGVVTMENDCANNNLQSYLVNGTLPKNGTMCKTETPTLPM
NGTDGAMLSIDDTGGKQKGSDDEGLPPL*
Coding >Ophun1|1900
ATGCGGTCTTTGTTTCTATACCTCGCCGCCTCGAGCGTCTTCCACGCCACGGCCTACTCCGCAGATGAGAAGCCA
AACAAGTACCCCGGCGAAAACATCAGCTGGACCCCCTGCGGAAATACGACCCAAGGGACTCCGCTAGAATGCAGC
AACATCACCGTGCCGGCGGATCAGTTCGCTCCCAAGAACCAGACCAGCGATCTCAAGTTCAAGATCCCGCTCATT
CGTCTCCGCAGCAAGAATGGGACCAAGAACTTGCTCTTCAACCCCGGCGGACCTGGCGGAAGTGGCGTCGGGGCA
ATCCGTGAGAACGGAGATGCACTCTTCAACGCCACCGGAGGCGACCATCACATCTTGTCGTTTGACCCCCGCGGC
GTCAAAGGGTCGGATCCGCAAGCTGCCTGCTCCTCCCTGTCACGGCCTGATCCGGAGACGCCCTTTGCGGTTCGA
AACCCGAAGCTGTACGCTTGGGCGACCTCGTACACCAAATCGTGCGCCGACATCATGGGTGAACACGGCAAGTTC
ATCAACACGCCCCAGACGGCGGCCGACATGAACAGCATCATCGACGCCGTCGGACAGAGCGACATGTACTTCCTG
GGCGTCAGTTACGGTTCCGTGCTGGGGCAGACGTACGCCAGCTTATTCCCGAAACGTTCCGCTCGCATCATCATC
GATAGCAACATCCACCTCAAAGAATATTACGAATCCAACGTCGACACCAGCACCTTTGACTACACGCACGAGGTC
TGGGAAGGCTTCATCCGCGAATGCTTCAAGGCCGGCAGCCGGTGTGCGCTGACGCCGCGCGCACGTTCCGAAAAG
GAGCTTCTCGACAAGGTGACGAGCTTCATCGACGGACTCGGGCCGGCACCCATGAGCATCTACGTCAACGCCACC
ACCAACGGGTTCCTCACCGCCTATGAAGTTTGGTTTGAAATCCAGCAAGCTCTTTACCGACCCGACTCATGGCGT
TCGACGGCTGCAATTCTCAATGACATGATGGACGGCAACGGCACGGAAGCACTCTTAGCATGGAAGAAAGGCGCG
GATGAAGAAGAAGATGAAGAAGACAAGGTGGATGCTGATGATGATACCAAAAACATGACAAAACCTGCCAGTACC
GAAGAGTCGTCGAGACTCGTCATCACGGCCAACGACCGCCCCTCGGGGCCGGCGAACTGGACTCAGGGCCTGGAT
TCCCTTGTCAAAGTGCTCACCCCCTCCTTCAACAAGTCGGCGCCATGGTATGAAACATGGAACCACGACTACTTC
ATACTACAGCAGTGGCCAATCAACAAAACCCATCCCTTCCAGGTGACCAAGAACGTCAACACGGCCTTCCCCATG
CTCATTCTACAGAACCGCTTCGACCCCGTCACCCCCTTGGTCGCAGCCCAGTTCGCCAGCCAGACCTTCAACGAC
TCACGCCTTGTCGTGGTCGATGGTTACGGACACGGTGTGGTGACGATGGAAAACGACTGCGCCAACAACAACTTG
CAGTCCTATCTAGTCAACGGGACGCTGCCGAAGAACGGCACCATGTGCAAGACCGAAACCCCGACCTTGCCTATG
AATGGCACTGATGGAGCTATGCTATCCATTGATGACACAGGGGGTAAGCAGAAAGGGTCAGATGACGAAGGTCTT
CCCCCGCTTTGA
Transcript >Ophun1|1900
ATGCGGTCTTTGTTTCTATACCTCGCCGCCTCGAGCGTCTTCCACGCCACGGCCTACTCCGCAGATGAGAAGCCA
AACAAGTACCCCGGCGAAAACATCAGCTGGACCCCCTGCGGAAATACGACCCAAGGGACTCCGCTAGAATGCAGC
AACATCACCGTGCCGGCGGATCAGTTCGCTCCCAAGAACCAGACCAGCGATCTCAAGTTCAAGATCCCGCTCATT
CGTCTCCGCAGCAAGAATGGGACCAAGAACTTGCTCTTCAACCCCGGCGGACCTGGCGGAAGTGGCGTCGGGGCA
ATCCGTGAGAACGGAGATGCACTCTTCAACGCCACCGGAGGCGACCATCACATCTTGTCGTTTGACCCCCGCGGC
GTCAAAGGGTCGGATCCGCAAGCTGCCTGCTCCTCCCTGTCACGGCCTGATCCGGAGACGCCCTTTGCGGTTCGA
AACCCGAAGCTGTACGCTTGGGCGACCTCGTACACCAAATCGTGCGCCGACATCATGGGTGAACACGGCAAGTTC
ATCAACACGCCCCAGACGGCGGCCGACATGAACAGCATCATCGACGCCGTCGGACAGAGCGACATGTACTTCCTG
GGCGTCAGTTACGGTTCCGTGCTGGGGCAGACGTACGCCAGCTTATTCCCGAAACGTTCCGCTCGCATCATCATC
GATAGCAACATCCACCTCAAAGAATATTACGAATCCAACGTCGACACCAGCACCTTTGACTACACGCACGAGGTC
TGGGAAGGCTTCATCCGCGAATGCTTCAAGGCCGGCAGCCGGTGTGCGCTGACGCCGCGCGCACGTTCCGAAAAG
GAGCTTCTCGACAAGGTGACGAGCTTCATCGACGGACTCGGGCCGGCACCCATGAGCATCTACGTCAACGCCACC
ACCAACGGGTTCCTCACCGCCTATGAAGTTTGGTTTGAAATCCAGCAAGCTCTTTACCGACCCGACTCATGGCGT
TCGACGGCTGCAATTCTCAATGACATGATGGACGGCAACGGCACGGAAGCACTCTTAGCATGGAAGAAAGGCGCG
GATGAAGAAGAAGATGAAGAAGACAAGGTGGATGCTGATGATGATACCAAAAACATGACAAAACCTGCCAGTACC
GAAGAGTCGTCGAGACTCGTCATCACGGCCAACGACCGCCCCTCGGGGCCGGCGAACTGGACTCAGGGCCTGGAT
TCCCTTGTCAAAGTGCTCACCCCCTCCTTCAACAAGTCGGCGCCATGGTATGAAACATGGAACCACGACTACTTC
ATACTACAGCAGTGGCCAATCAACAAAACCCATCCCTTCCAGGTGACCAAGAACGTCAACACGGCCTTCCCCATG
CTCATTCTACAGAACCGCTTCGACCCCGTCACCCCCTTGGTCGCAGCCCAGTTCGCCAGCCAGACCTTCAACGAC
TCACGCCTTGTCGTGGTCGATGGTTACGGACACGGTGTGGTGACGATGGAAAACGACTGCGCCAACAACAACTTG
CAGTCCTATCTAGTCAACGGGACGCTGCCGAAGAACGGCACCATGTGCAAGACCGAAACCCCGACCTTGCCTATG
AATGGCACTGATGGAGCTATGCTATCCATTGATGACACAGGGGGTAAGCAGAAAGGGTCAGATGACGAAGGTCTT
CCCCCGCTTTGA
Gene >Ophun1|1900
ATGCGGTCTTTGTTTCTATACCTCGCCGCCTCGAGCGTCTTCCACGCCACGGCCTACTCCGCAGATGAGAAGCCA
AACAAGTACCCCGGCGAAAACATCAGCTGGACCCCCTGCGGAAATACGACCCAAGGGACTCCGCTAGAATGCAGC
AACATCACCGTGCCGGCGGATCAGTTCGCTCCCAAGAACCAGACCAGCGATCTCAAGTTCAAGATCCCGCTCATT
CGTCTCCGCAGCAAGAATGGGACCAAGAACTTGCTCTTCAACCCCGGCGGACCTGGCGGAAGTGGCGTCGGGGCA
ATCCGTGAGAACGGAGATGCACTCTTCAACGCCACCGGAGGCGACCATCACATCTTGTCGTTTGACCCCCGCGGC
GTCAAAGGGTCGGATCCGCAAGCTGCCTGCTCCTCCCTGTCACGGCCTGATCCGGAGACGCCCTTTGCGGTTCGA
AACCCGAAGCTGTACGCTTGGGCGACCTCGTACACCAAATCGTGCGCCGACATCATGGGTGAACACGGCAAGTTC
ATCAACACGCCCCAGACGGCGGCCGACATGAACAGCATCATCGACGCCGTCGGACAGAGCGACATGTACTTCCTG
GGCGTCAGTTACGGTTCCGTGCTGGGGCAGACGTACGCCAGCTTATTCCCGAAACGTTCCGCTCGCATCATCATC
GATAGCAACATCCACCTCAAAGAATATTACGAATCCAACGTCGACACCAGCACCTTTGACTACACGCACGAGGTC
TGGGAAGGCTTCATCCGCGAATGCTTCAAGGCCGGCAGCCGGTGTGCGCTGACGCCGCGCGCACGTTCCGAAAAG
GAGCTTCTCGACAAGGTGACGAGCTTCATCGACGGACTCGGGCCGGCACCCATGAGCATCTACGTCAACGCCACC
ACCAACGGGTTCCTCACCGCCTATGAAGTTTGGTTTGAAATCCAGCAAGCTCTTTACCGACCCGACTCATGGCGT
TCGACGGCTGCAATTCTCAATGACATGATGGACGGCAACGGCACGGAAGCACTCTTAGCATGGAAGAAAGGCGCG
GATGAAGAAGAAGATGAAGAAGACAAGGTGGATGCTGATGATGATACCAAAAACATGACAAAACCTGCCAGTACC
GAAGAGTCGTCGAGACTCGTCATCACGGCCAACGACCGCCCCTCGGGGCCGGCGAACTGGACTCAGGGCCTGGAT
TCCCTTGTCAAAGTGCTCACCCCCTCCTTCAACAAGTCGGCGCCATGGTATGAAACATGGAACCACGACTACTTC
ATACTACAGCAGTGGCCAATCAACAAAACCCATCCCTTCCAGGTGACCAAGAACGTCAACACGGCCTTCCCCATG
CTCATTCTACAGAACCGCTTCGACCCCGTCACCCCCTTGGTCGCAGCCCAGTTCGCCAGCCAGACCTTCAACGAC
TCACGCCTTGTCGTGGTCGATGGTTACGGACACGGTGTGGTGACGATGGAAAACGACTGCGCCAACAACAACTTG
CAGTCCTATCTAGTCAACGGGACGCTGCCGAAGAACGGCACCATGTGCAAGACCGAAACCCCGACCTTGCCTATG
AATGGCACTGATGGAGCTATGCTATCCATTGATGACACAGGGGGTAAGCAGAAAGGGTCAGATGACGAAGGTCTT
CCCCCGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail