Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1897
Gene name
LocationContig_185:18409..19434
Strand-
Gene length (bp)1025
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 7.6E-21 103 280

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 106 128 22
3 143 165 22
4 178 200 22
5 215 237 22
6 258 280 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1897
MILSSTLYGSLNLTTAPASPESFSSPLHLVSPGRRPGTRCGDAFINARHWPEASAMASTASLVCPPEPLRHPLPP
SALSVSVTFVALWAVLAIVHFLLGRRGVARFVICAFLLYLAPVFFTAAIHAAVVEALADVSRTSRHLSPVLVDGL
FIGLDIVCFALVMVGSALDTTTGRGAASTLLLAGLAVELTTLTAAVAVLVDLWVVRSRSTHPPRFTWRRRISLLA
LALASLFLVVRCAYDVADVCRGWLSVAEETTLLIVDGVLTLVVGLILCVVHAARIPQVSISEETVEQK*
Coding >Ophun1|1897
ATGATCCTCTCCAGCACACTGTACGGCAGCCTCAACCTGACGACAGCTCCTGCGTCCCCCGAGTCCTTCAGCTCC
CCCCTTCATCTCGTCTCCCCTGGTCGACGCCCTGGCACCCGCTGTGGCGATGCCTTCATCAATGCCCGACACTGG
CCTGAGGCCTCTGCCATGGCGTCGACCGCGTCGCTCGTCTGTCCGCCAGAACCGCTCCGTCATCCGCTCCCTCCA
TCTGCGCTGTCCGTCAGCGTGACTTTCGTTGCTCTCTGGGCCGTCTTGGCCATTGTCCACTTTCTTCTCGGTCGT
CGTGGCGTCGCTCGTTTCGTCATCTGCGCATTTCTTCTCTATCTCGCGCCCGTCTTCTTCACGGCTGCCATTCAC
GCTGCTGTCGTCGAGGCCTTGGCTGATGTGTCGCGGACATCGCGCCATCTGTCGCCGGTTCTTGTCGATGGCCTC
TTCATCGGTCTCGATATCGTGTGCTTCGCTCTCGTCATGGTTGGCAGCGCTTTGGATACCACAACGGGTCGTGGT
GCTGCCTCGACGTTGCTCTTGGCTGGCCTTGCAGTGGAATTGACGACGCTGACTGCCGCTGTGGCTGTTCTCGTC
GACCTCTGGGTTGTTCGCTCTCGCTCTACTCATCCGCCACGCTTCACCTGGCGGCGCAGAATCTCGCTACTTGCT
CTGGCCCTGGCCTCCCTCTTTCTCGTCGTTCGCTGTGCCTACGACGTCGCCGACGTGTGCCGCGGCTGGCTGTCA
GTGGCAGAAGAGACAACTCTGCTCATCGTCGACGGCGTCTTGACCCTCGTCGTTGGCTTGATCCTCTGTGTCGTT
CACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAAGAAACCGTGGAGCAAAAGTAG
Transcript >Ophun1|1897
ATGATCCTCTCCAGCACACTGTACGGCAGCCTCAACCTGACGACAGCTCCTGCGTCCCCCGAGTCCTTCAGCTCC
CCCCTTCATCTCGTCTCCCCTGGTCGACGCCCTGGCACCCGCTGTGGCGATGCCTTCATCAATGCCCGACACTGG
CCTGAGGCCTCTGCCATGGCGTCGACCGCGTCGCTCGTCTGTCCGCCAGAACCGCTCCGTCATCCGCTCCCTCCA
TCTGCGCTGTCCGTCAGCGTGACTTTCGTTGCTCTCTGGGCCGTCTTGGCCATTGTCCACTTTCTTCTCGGTCGT
CGTGGCGTCGCTCGTTTCGTCATCTGCGCATTTCTTCTCTATCTCGCGCCCGTCTTCTTCACGGCTGCCATTCAC
GCTGCTGTCGTCGAGGCCTTGGCTGATGTGTCGCGGACATCGCGCCATCTGTCGCCGGTTCTTGTCGATGGCCTC
TTCATCGGTCTCGATATCGTGTGCTTCGCTCTCGTCATGGTTGGCAGCGCTTTGGATACCACAACGGGTCGTGGT
GCTGCCTCGACGTTGCTCTTGGCTGGCCTTGCAGTGGAATTGACGACGCTGACTGCCGCTGTGGCTGTTCTCGTC
GACCTCTGGGTTGTTCGCTCTCGCTCTACTCATCCGCCACGCTTCACCTGGCGGCGCAGAATCTCGCTACTTGCT
CTGGCCCTGGCCTCCCTCTTTCTCGTCGTTCGCTGTGCCTACGACGTCGCCGACGTGTGCCGCGGCTGGCTGTCA
GTGGCAGAAGAGACAACTCTGCTCATCGTCGACGGCGTCTTGACCCTCGTCGTTGGCTTGATCCTCTGTGTCGTT
CACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAAGAAACCGTGGAGCAAAAGTAG
Gene >Ophun1|1897
ATGATCCTCTCCAGCACACTGTACGGCAGCCTCAACCTGACGACAGCTCCTGCGTCCCCCGAGTCCTTCAGCTCC
CCCCTTCATCTCGTCTCCCCTGGTCGACGCCCTGGCACCCGCTGTGGCGATGCCTTCATCAATGCCCGACACTGG
CCTGAGGCCTCTGCCATGGCGTCGACCGCGTCGCTCGTCTGTCCGCCAGAACCGCTCCGTCATCCGCTCCCTCCA
TCTGCGCTGTCCGTCAGCGTGACTTTCGTTGCTCTCTGGGCCGTCTTGGCCATTGTCCACTTTCTTCTCGGTCGT
CGTGGCGTCGCTCGTTTCGTCATCTGCGCATGTATCGGGTGTCTCTTGGCGCTGGGGGCTTTCGTCGGGGGTATC
GTGCGATGGCGTTATGCCCTTTCGTGCGCTGGCTTCGCTGCTGAAGTTGGTATGAGCCTTGAGTCTTTTGTTGTG
GCCTTTTGTCGAGTTATCTTGCAGTTCTTCTCTATCTCGCGCCCGTCTTCTTCACGGCTGCCATTCACGCTGCTG
TCGTCGAGGCCTTGGCTGATGTGTCGCGGACATCGCGCCATCTGTCGCCGGTTCTTGTCGATGGCCTCTTCATCG
GTCTCGATATCGTGTGCTTCGCTCTCGTCATGGTTGGCAGCGCTTTGGATACCACAACGGGTCGTGGTGCTGCCT
CGACGTTGCTCTTGGCTGGCCTTGCAGTGGAATTGACGACGCTGACTGCCGCTGTGGCTGTTCTCGTCGACCTCT
GGGTTGTTCGCTCTCGCTCTACTCATCCGCCACGCTTCACCTGGCGGCGCAGAATCTCGCTACTTGCTCTGGCCC
TGGCCTCCCTCTTTCTCGTCGTTCGCTGTGCCTACGACGTCGCCGACGTGTGCCGCGGCTGGCTGTCAGTGGCAG
AAGAGACAACTCTGCTCATCGTCGACGGCGTCTTGACCCTCGTCGTTGGCTTGATCCTCTGTGTCGTTCACGCCG
CTCGCATCCCCCAGGTGTCCATCTCAGAAGAAACCGTGGAGCAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail