Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1883
Gene name
LocationContig_184:16027..18155
Strand+
Gene length (bp)2128
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.3E-03 302 340
PF00400 WD40 WD domain, G-beta repeat 2.9E-04 344 380
PF00400 WD40 WD domain, G-beta repeat 6.5E-04 425 458
PF00400 WD40 WD domain, G-beta repeat 8.3E-06 535 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 6 654 0.0E+00
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 6 654 0.0E+00
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 3 654 0.0E+00
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 10 654 0.0E+00
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 19 654 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 6 654 0.0E+00
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 6 654 0.0E+00
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 3 654 0.0E+00
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 10 654 0.0E+00
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 19 654 0.0E+00
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 5 654 0.0E+00
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 21 654 0.0E+00
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 5 654 0.0E+00
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 5 654 0.0E+00
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 5 654 0.0E+00
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 5 654 0.0E+00
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 19 654 0.0E+00
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 19 654 0.0E+00
sp|Q6CB13|MDV1_YARLI Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 27 654 9.0E-141
sp|Q758R7|MDV1_ASHGO Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 86 652 4.0E-109
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 52 652 8.0E-108
sp|A7THX0|MDV1_VANPO Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 75 652 3.0E-92
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 74 652 7.0E-92
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 74 652 4.0E-91
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 81 654 7.0E-88
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 115 653 4.0E-84
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 85 652 2.0E-80
sp|P0CS44|MDV1_CRYNJ Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 150 652 1.0E-79
sp|P0CS45|MDV1_CRYNB Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 150 652 1.0E-79
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 274 652 4.0E-77
sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 104 653 2.0E-74
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 104 653 5.0E-74
sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 300 647 5.0E-69
sp|Q6FLI3|CAF4_CANGA CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 306 633 5.0E-52
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 308 652 2.0E-29
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 305 614 4.0E-29
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 302 652 1.0E-28
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 308 652 2.0E-28
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 306 652 5.0E-28
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 306 652 8.0E-28
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 327 573 5.0E-27
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 302 573 6.0E-27
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 302 573 6.0E-27
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 302 573 7.0E-27
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 302 568 2.0E-24
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 302 568 2.0E-24
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 257 573 3.0E-24
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 302 568 3.0E-24
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 305 612 6.0E-24
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 304 608 9.0E-24
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 308 602 2.0E-23
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 304 608 3.0E-23
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 308 607 5.0E-23
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 302 568 5.0E-23
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 302 574 6.0E-23
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 302 613 1.0E-22
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 302 613 1.0E-22
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 302 568 1.0E-22
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 302 613 3.0E-22
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 302 568 3.0E-22
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 265 628 3.0E-22
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 308 607 4.0E-22
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 307 608 6.0E-22
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 265 628 7.0E-22
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 327 608 1.0E-21
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 302 612 1.0E-21
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 308 608 2.0E-21
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 302 612 3.0E-21
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 276 579 4.0E-21
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 302 568 4.0E-21
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 305 572 5.0E-21
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 302 577 1.0E-20
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 308 568 2.0E-20
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 286 573 2.0E-20
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 304 571 3.0E-20
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 295 573 4.0E-20
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 327 612 7.0E-20
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 327 575 3.0E-19
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 305 602 3.0E-19
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 344 652 5.0E-19
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 308 654 5.0E-19
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 305 607 7.0E-19
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 308 654 8.0E-19
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 276 608 8.0E-19
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 259 573 9.0E-19
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 299 571 1.0E-18
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 294 573 1.0E-18
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 300 607 1.0E-18
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 306 575 2.0E-18
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 306 575 2.0E-18
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 306 575 2.0E-18
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 305 607 2.0E-18
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 305 607 2.0E-18
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 308 590 2.0E-18
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 308 590 2.0E-18
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 306 575 3.0E-18
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 310 568 3.0E-18
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 308 612 3.0E-18
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 218 607 4.0E-18
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 333 572 4.0E-18
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 302 612 4.0E-18
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 305 573 5.0E-18
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 300 607 5.0E-18
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 300 607 5.0E-18
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 294 607 6.0E-18
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 308 654 9.0E-18
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 308 571 1.0E-17
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 302 612 1.0E-17
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 308 611 2.0E-17
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 306 575 2.0E-17
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 308 571 2.0E-17
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 294 607 2.0E-17
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 294 607 2.0E-17
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 305 571 2.0E-17
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 308 616 2.0E-17
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 305 573 3.0E-17
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 301 572 3.0E-17
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 308 654 3.0E-17
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 305 571 3.0E-17
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 308 654 3.0E-17
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 305 607 3.0E-17
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 305 571 3.0E-17
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 308 654 4.0E-17
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 305 573 5.0E-17
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 305 617 5.0E-17
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 305 571 5.0E-17
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 305 571 5.0E-17
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 305 571 5.0E-17
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 305 571 5.0E-17
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 306 608 5.0E-17
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 305 571 5.0E-17
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 305 571 5.0E-17
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 306 608 7.0E-17
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 308 569 7.0E-17
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 283 605 8.0E-17
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 308 617 8.0E-17
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 306 608 8.0E-17
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 305 571 8.0E-17
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 279 607 9.0E-17
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 279 607 9.0E-17
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 305 571 9.0E-17
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 294 607 9.0E-17
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 305 571 1.0E-16
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 306 573 1.0E-16
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 300 607 1.0E-16
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 306 608 1.0E-16
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 308 652 1.0E-16
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 306 608 2.0E-16
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 308 573 2.0E-16
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 305 571 2.0E-16
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 314 608 2.0E-16
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 308 571 2.0E-16
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 306 608 2.0E-16
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 305 575 3.0E-16
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 314 608 3.0E-16
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 305 571 3.0E-16
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 308 571 4.0E-16
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 300 572 4.0E-16
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 305 571 4.0E-16
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 308 645 4.0E-16
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 326 518 5.0E-16
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 501 608 5.0E-16
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 300 572 6.0E-16
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 300 572 6.0E-16
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 299 570 7.0E-16
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 299 567 7.0E-16
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 306 590 7.0E-16
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 308 654 7.0E-16
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 308 654 7.0E-16
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 299 570 8.0E-16
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 301 571 8.0E-16
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 305 571 8.0E-16
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 428 613 8.0E-16
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 301 571 9.0E-16
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 302 540 1.0E-15
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 308 654 1.0E-15
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 302 613 1.0E-15
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 259 616 1.0E-15
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 259 616 1.0E-15
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 350 612 1.0E-15
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 308 570 1.0E-15
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 344 580 1.0E-15
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 299 568 2.0E-15
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 276 630 2.0E-15
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 308 654 2.0E-15
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 327 574 2.0E-15
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 308 654 2.0E-15
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 302 575 3.0E-15
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 308 654 3.0E-15
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 308 654 3.0E-15
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 276 645 3.0E-15
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 427 652 3.0E-15
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 308 654 4.0E-15
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 303 645 4.0E-15
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 426 652 4.0E-15
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 305 573 5.0E-15
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 500 653 5.0E-15
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 304 546 5.0E-15
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 426 652 7.0E-15
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 426 652 7.0E-15
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 426 652 7.0E-15
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 303 573 7.0E-15
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 307 616 7.0E-15
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 311 654 8.0E-15
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 426 652 1.0E-14
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 501 608 1.0E-14
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 501 608 1.0E-14
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 295 469 1.0E-14
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 295 469 1.0E-14
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 308 654 1.0E-14
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 308 654 1.0E-14
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 308 654 1.0E-14
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 308 570 1.0E-14
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 424 652 2.0E-14
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 299 531 2.0E-14
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 426 652 2.0E-14
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 501 608 2.0E-14
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 501 608 2.0E-14
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 311 570 2.0E-14
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 308 654 2.0E-14
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 299 572 2.0E-14
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 306 570 2.0E-14
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 276 645 2.0E-14
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 423 608 3.0E-14
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 501 608 3.0E-14
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 501 608 3.0E-14
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 298 652 3.0E-14
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 305 571 3.0E-14
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 304 528 3.0E-14
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 327 608 3.0E-14
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 305 469 3.0E-14
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 501 608 4.0E-14
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 501 608 4.0E-14
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 276 616 4.0E-14
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 276 616 4.0E-14
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 304 468 4.0E-14
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 299 568 5.0E-14
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 423 608 6.0E-14
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 294 569 6.0E-14
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 306 590 6.0E-14
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 302 575 7.0E-14
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 302 568 7.0E-14
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 423 608 8.0E-14
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 303 625 8.0E-14
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 381 652 9.0E-14
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 300 457 1.0E-13
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 428 613 1.0E-13
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 423 613 1.0E-13
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 423 613 1.0E-13
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 501 608 1.0E-13
sp|Q9AV81|PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 388 607 1.0E-13
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 425 652 1.0E-13
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 381 652 2.0E-13
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 308 631 2.0E-13
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 308 645 2.0E-13
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 275 631 2.0E-13
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 501 608 3.0E-13
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 501 608 3.0E-13
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 501 608 3.0E-13
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 423 613 3.0E-13
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 304 571 3.0E-13
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 304 525 3.0E-13
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 304 525 3.0E-13
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 304 571 3.0E-13
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 305 468 4.0E-13
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 425 613 4.0E-13
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 429 652 4.0E-13
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 381 652 4.0E-13
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 395 652 4.0E-13
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 305 608 4.0E-13
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 304 571 5.0E-13
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 302 602 5.0E-13
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 306 654 5.0E-13
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 425 615 5.0E-13
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 353 608 6.0E-13
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 302 602 6.0E-13
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 305 468 7.0E-13
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 305 468 8.0E-13
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 428 613 9.0E-13
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 295 620 9.0E-13
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 425 615 9.0E-13
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 428 613 1.0E-12
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 423 608 1.0E-12
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 425 631 2.0E-12
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 300 457 2.0E-12
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 302 558 2.0E-12
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 302 568 2.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 308 596 2.0E-12
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 425 615 2.0E-12
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 305 577 2.0E-12
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 311 576 2.0E-12
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 314 570 2.0E-12
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 423 608 3.0E-12
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 430 652 3.0E-12
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 423 608 3.0E-12
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 425 615 3.0E-12
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 425 615 3.0E-12
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 426 578 3.0E-12
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 304 468 3.0E-12
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 295 468 3.0E-12
sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 204 606 3.0E-12
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 366 574 3.0E-12
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 428 652 4.0E-12
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 304 468 4.0E-12
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 306 612 4.0E-12
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 303 528 5.0E-12
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 303 528 5.0E-12
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 304 571 5.0E-12
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 428 613 6.0E-12
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 343 580 6.0E-12
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 305 469 6.0E-12
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 304 468 6.0E-12
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 423 608 7.0E-12
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 423 608 7.0E-12
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 299 467 7.0E-12
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 366 575 8.0E-12
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 435 652 9.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 299 568 9.0E-12
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 306 568 9.0E-12
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 304 471 9.0E-12
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 423 608 1.0E-11
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 423 608 1.0E-11
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 425 608 1.0E-11
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 306 590 1.0E-11
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 276 573 1.0E-11
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 308 568 1.0E-11
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 303 608 1.0E-11
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 304 551 2.0E-11
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 427 652 2.0E-11
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 300 572 2.0E-11
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 435 652 3.0E-11
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 304 468 3.0E-11
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 311 568 3.0E-11
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 435 652 4.0E-11
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 304 468 4.0E-11
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 295 468 4.0E-11
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 425 653 4.0E-11
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 304 468 4.0E-11
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 304 468 4.0E-11
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 425 652 4.0E-11
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 295 468 4.0E-11
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 300 457 5.0E-11
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 423 608 5.0E-11
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 423 608 5.0E-11
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 366 571 5.0E-11
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 304 468 5.0E-11
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 298 590 5.0E-11
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 299 469 6.0E-11
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 308 631 6.0E-11
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 308 631 6.0E-11
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 308 608 6.0E-11
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 298 590 6.0E-11
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 299 382 7.0E-11
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 435 652 7.0E-11
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 435 652 7.0E-11
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 298 590 7.0E-11
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 315 568 8.0E-11
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 295 471 8.0E-11
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 311 614 8.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 298 464 1.0E-10
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 501 613 1.0E-10
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 430 613 1.0E-10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 315 568 1.0E-10
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 302 652 1.0E-10
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 299 465 1.0E-10
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 305 553 1.0E-10
sp|Q6DH44|WDR83_DANRE WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 289 580 1.0E-10
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 302 614 1.0E-10
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 428 613 2.0E-10
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 502 653 2.0E-10
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 299 469 2.0E-10
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 305 578 2.0E-10
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 304 546 2.0E-10
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 304 571 2.0E-10
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 305 568 2.0E-10
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 427 653 2.0E-10
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 304 553 2.0E-10
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 428 608 2.0E-10
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 428 608 2.0E-10
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 302 602 2.0E-10
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 304 568 2.0E-10
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 299 469 3.0E-10
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 299 461 3.0E-10
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 302 602 3.0E-10
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 305 570 3.0E-10
sp|Q8NAA4|A16L2_HUMAN Autophagy-related protein 16-2 OS=Homo sapiens GN=ATG16L2 PE=1 SV=2 345 582 3.0E-10
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 303 568 4.0E-10
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 304 571 4.0E-10
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 306 603 4.0E-10
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 209 616 4.0E-10
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 311 590 4.0E-10
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 295 468 4.0E-10
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 413 608 5.0E-10
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 308 567 5.0E-10
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 403 572 6.0E-10
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 305 568 6.0E-10
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 309 467 6.0E-10
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 366 630 6.0E-10
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 305 568 6.0E-10
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 425 608 6.0E-10
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 299 631 7.0E-10
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 513 653 8.0E-10
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 306 607 8.0E-10
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 305 568 8.0E-10
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 348 608 8.0E-10
sp|Q6KAU8|A16L2_MOUSE Autophagy-related protein 16-2 OS=Mus musculus GN=Atg16l2 PE=2 SV=2 274 582 8.0E-10
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 502 653 9.0E-10
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 502 653 9.0E-10
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 327 468 9.0E-10
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 306 571 9.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 322 469 1.0E-09
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 351 575 1.0E-09
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 228 574 1.0E-09
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 305 574 1.0E-09
sp|B4MU54|WDR12_DROWI Ribosome biogenesis protein WDR12 homolog OS=Drosophila willistoni GN=GK23981 PE=3 SV=1 302 607 1.0E-09
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 302 602 1.0E-09
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 345 652 1.0E-09
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 513 613 1.0E-09
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 327 570 1.0E-09
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 325 574 1.0E-09
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 325 574 1.0E-09
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 516 652 1.0E-09
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 265 652 1.0E-09
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 304 468 1.0E-09
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 350 608 1.0E-09
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 304 468 2.0E-09
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 304 468 2.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 349 611 2.0E-09
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 516 652 2.0E-09
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 366 608 2.0E-09
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 302 568 2.0E-09
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 516 652 2.0E-09
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 516 652 2.0E-09
sp|Q9FE91|C3H62_ARATH Zinc finger CCCH domain-containing protein 62 OS=Arabidopsis thaliana GN=ZFWD4 PE=2 SV=1 427 606 2.0E-09
sp|Q5RAC9|A16L1_PONAB Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 347 580 2.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 349 612 2.0E-09
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 305 571 2.0E-09
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 394 652 2.0E-09
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 305 574 2.0E-09
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 357 570 2.0E-09
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 363 570 2.0E-09
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 303 570 2.0E-09
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 315 593 2.0E-09
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 300 571 3.0E-09
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 305 573 3.0E-09
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 305 573 3.0E-09
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 299 459 4.0E-09
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 427 652 4.0E-09
sp|Q6BU94|PRP46_DEBHA Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 348 601 4.0E-09
sp|Q5XX13|FBW10_HUMAN F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 513 653 4.0E-09
sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 302 652 4.0E-09
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 295 486 5.0E-09
sp|C5DF48|LIS1_LACTC Nuclear distribution protein PAC1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PAC1 PE=3 SV=1 305 567 5.0E-09
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 353 601 5.0E-09
sp|O13615|PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 299 468 5.0E-09
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 302 456 5.0E-09
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 205 461 5.0E-09
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 397 653 5.0E-09
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 397 653 5.0E-09
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 430 613 6.0E-09
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 425 612 6.0E-09
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 427 568 6.0E-09
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 299 468 6.0E-09
sp|Q9DAJ4|WDR83_MOUSE WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 403 608 6.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 327 609 6.0E-09
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 306 460 7.0E-09
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 430 613 7.0E-09
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 427 568 7.0E-09
sp|O95170|CDRT1_HUMAN CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 513 653 7.0E-09
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 380 571 8.0E-09
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 299 461 9.0E-09
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 516 652 9.0E-09
sp|Q9JMJ2|FBXW4_MOUSE F-box/WD repeat-containing protein 4 OS=Mus musculus GN=Fbxw4 PE=2 SV=1 344 574 9.0E-09
sp|P57775|FBXW4_HUMAN F-box/WD repeat-containing protein 4 OS=Homo sapiens GN=FBXW4 PE=2 SV=1 327 572 9.0E-09
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 308 608 9.0E-09
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 303 527 1.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 513 613 1.0E-08
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 300 572 1.0E-08
sp|Q54N86|FBXAL_DICDI F-box/WD repeat-containing protein A-like protein OS=Dictyostelium discoideum GN=DDB_G0285445 PE=3 SV=1 350 652 1.0E-08
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 306 571 1.0E-08
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 501 608 1.0E-08
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 357 570 1.0E-08
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 300 528 2.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 513 613 2.0E-08
sp|Q5A7Q3|PRP46_CANAL Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 310 568 2.0E-08
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 305 570 2.0E-08
sp|Q0DYP5|C3H17_ORYSJ Zinc finger CCCH domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=Os02g0677700 PE=2 SV=2 425 601 2.0E-08
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 304 468 2.0E-08
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 304 468 2.0E-08
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 306 568 2.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 427 568 2.0E-08
sp|F4JY12|GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana GN=GFS12 PE=1 SV=1 302 571 2.0E-08
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 357 570 2.0E-08
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 427 652 2.0E-08
sp|Q9FNZ2|C3H48_ARATH Zinc finger CCCH domain-containing protein 48 OS=Arabidopsis thaliana GN=ZFWD1 PE=2 SV=1 425 612 2.0E-08
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 427 568 2.0E-08
sp|Q9FNZ1|C3H63_ARATH Zinc finger CCCH domain-containing protein 63 OS=Arabidopsis thaliana GN=ZFWD2 PE=2 SV=1 425 612 2.0E-08
sp|P27612|PLAP_MOUSE Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 299 385 2.0E-08
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 427 652 2.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 427 568 2.0E-08
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 302 602 2.0E-08
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 305 459 3.0E-08
sp|Q5BJQ6|CSTF1_RAT Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 366 652 3.0E-08
sp|Q99LC2|CSTF1_MOUSE Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 366 652 3.0E-08
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 357 570 3.0E-08
sp|P36037|DOA1_YEAST Protein DOA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA1 PE=1 SV=1 367 604 3.0E-08
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 357 570 3.0E-08
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 357 570 3.0E-08
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 357 570 3.0E-08
sp|Q5BLX8|WDR83_RAT WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 403 608 3.0E-08
sp|Q8BH57|WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 357 570 3.0E-08
sp|Q05048|CSTF1_HUMAN Cleavage stimulation factor subunit 1 OS=Homo sapiens GN=CSTF1 PE=1 SV=1 366 652 3.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 305 461 4.0E-08
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 307 468 4.0E-08
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 327 568 4.0E-08
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 427 569 4.0E-08
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 397 653 4.0E-08
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 309 385 4.0E-08
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 299 469 5.0E-08
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 302 488 5.0E-08
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 308 582 5.0E-08
sp|Q6C709|PRP46_YARLI Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 264 468 5.0E-08
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 304 468 5.0E-08
sp|Q6NX08|WDR12_DANRE Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 302 602 6.0E-08
sp|O94967|WDR47_HUMAN WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 366 571 6.0E-08
sp|Q9C1X0|YN55_SCHPO Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 302 532 6.0E-08
sp|Q8CGF6|WDR47_MOUSE WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 366 571 6.0E-08
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 299 620 6.0E-08
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 443 608 7.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 305 462 7.0E-08
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 311 577 7.0E-08
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 428 608 7.0E-08
sp|B5DG67|WDR12_SALSA Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 307 602 7.0E-08
sp|Q09406|A16L2_CAEEL Autophagic-related protein 16.2 OS=Caenorhabditis elegans GN=atg-16.2 PE=3 SV=2 162 604 7.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 350 573 8.0E-08
sp|Q5I0B9|ATG16_XENTR Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 424 593 8.0E-08
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 299 464 8.0E-08
sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 299 385 9.0E-08
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 427 569 9.0E-08
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 445 652 9.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 302 381 1.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 298 410 1.0E-07
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 315 529 1.0E-07
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 301 483 1.0E-07
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 427 569 1.0E-07
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 299 466 1.0E-07
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 300 468 1.0E-07
sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 306 652 1.0E-07
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 445 652 1.0E-07
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 300 468 1.0E-07
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 326 575 1.0E-07
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 426 652 1.0E-07
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 300 468 1.0E-07
sp|Q58D00|FBXW2_BOVIN F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 350 468 1.0E-07
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 300 468 1.0E-07
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 426 575 1.0E-07
sp|Q9UKT8|FBXW2_HUMAN F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 350 468 1.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 305 477 2.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 427 575 2.0E-07
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 300 468 2.0E-07
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 303 459 2.0E-07
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 300 468 2.0E-07
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 427 652 2.0E-07
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 428 569 2.0E-07
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 299 466 2.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 427 575 2.0E-07
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 305 617 2.0E-07
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 305 617 2.0E-07
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 299 386 3.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 240 386 3.0E-07
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 240 386 3.0E-07
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 516 608 3.0E-07
sp|Q6DH44|WDR83_DANRE WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 403 572 3.0E-07
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 419 591 3.0E-07
sp|Q5BE22|PRP46_EMENI Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 299 470 3.0E-07
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 325 539 3.0E-07
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 300 459 3.0E-07
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 419 591 4.0E-07
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 419 591 4.0E-07
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 308 608 4.0E-07
sp|Q756D0|YTM1_ASHGO Ribosome biogenesis protein YTM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YTM1 PE=3 SV=2 310 457 4.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 425 572 4.0E-07
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 348 652 4.0E-07
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 309 463 4.0E-07
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 300 468 5.0E-07
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 325 570 5.0E-07
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 426 652 5.0E-07
sp|Q756D0|YTM1_ASHGO Ribosome biogenesis protein YTM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YTM1 PE=3 SV=2 502 653 5.0E-07
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 308 570 5.0E-07
sp|Q9FKR9|C3H59_ARATH Zinc finger CCCH domain-containing protein 59 OS=Arabidopsis thaliana GN=ZFWD3 PE=2 SV=1 428 602 5.0E-07
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 498 573 6.0E-07
sp|Q9Y0T2|FBXA_DICDI F-box/WD repeat-containing protein A OS=Dictyostelium discoideum GN=fbxA PE=1 SV=2 306 381 6.0E-07
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 307 469 6.0E-07
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 350 652 6.0E-07
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 427 608 6.0E-07
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 305 395 7.0E-07
sp|Q9VPH8|RBBP5_DROME Retinoblastoma-binding protein 5 homolog OS=Drosophila melanogaster GN=Rbbp5 PE=1 SV=2 508 594 7.0E-07
sp|Q60584|FBXW2_MOUSE F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 350 468 7.0E-07
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 299 471 8.0E-07
sp|B2RZ17|FBXW2_RAT F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 350 468 9.0E-07
sp|P18851|GBB_YEAST Guanine nucleotide-binding protein subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE4 PE=1 SV=2 322 568 9.0E-07
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 303 623 1.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 302 614 1.0E-06
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 310 461 1.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 426 608 1.0E-06
sp|P0CS48|PRP46_CRYNJ Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 299 468 1.0E-06
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 426 571 1.0E-06
sp|P0CS49|PRP46_CRYNB Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 299 468 1.0E-06
sp|P38123|SWD3_YEAST COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1 515 654 1.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 323 605 1.0E-06
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 307 469 1.0E-06
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 310 457 1.0E-06
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 310 381 1.0E-06
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 514 652 2.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 426 573 2.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 473 612 2.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 389 573 2.0E-06
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 302 391 2.0E-06
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 419 591 2.0E-06
sp|Q6L4F8|GBLPB_ORYSJ Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 300 469 2.0E-06
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 299 473 2.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 305 381 2.0E-06
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 302 391 2.0E-06
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 299 466 2.0E-06
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 299 466 2.0E-06
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 345 608 2.0E-06
sp|Q19124|A16L1_CAEEL Autophagic-related protein 16.1 OS=Caenorhabditis elegans GN=atg-16.1 PE=3 SV=1 367 604 2.0E-06
sp|Q499N3|WDR18_RAT WD repeat-containing protein 18 OS=Rattus norvegicus GN=Wdr18 PE=2 SV=1 320 493 2.0E-06
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 427 652 2.0E-06
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 516 608 2.0E-06
sp|Q12220|UTP12_YEAST U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 325 467 2.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 516 652 3.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 327 568 3.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 308 457 3.0E-06
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 412 570 3.0E-06
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 412 570 3.0E-06
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 430 573 3.0E-06
sp|Q12024|YTM1_YEAST Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTM1 PE=1 SV=1 502 571 3.0E-06
sp|A6ZPA9|YTM1_YEAS7 Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YTM1 PE=3 SV=1 502 571 3.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 308 573 3.0E-06
sp|Q9GZS3|WDR61_HUMAN WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 326 617 3.0E-06
sp|Q75BY3|PRP46_ASHGO Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 327 579 3.0E-06
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 299 382 4.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 308 608 4.0E-06
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 501 608 4.0E-06
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 501 608 4.0E-06
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 501 608 4.0E-06
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 501 608 4.0E-06
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 501 608 4.0E-06
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 501 608 4.0E-06
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 501 608 4.0E-06
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 299 437 4.0E-06
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 311 463 4.0E-06
sp|Q9WVB3|TLE6_MOUSE Transducin-like enhancer protein 6 OS=Mus musculus GN=Tle6 PE=1 SV=1 515 588 4.0E-06
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 501 569 4.0E-06
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 325 463 4.0E-06
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 303 608 4.0E-06
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 292 468 5.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 311 607 5.0E-06
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 305 570 5.0E-06
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 305 617 5.0E-06
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 300 459 5.0E-06
sp|P87060|POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 505 579 6.0E-06
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 425 654 6.0E-06
sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 305 573 6.0E-06
sp|Q12417|PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 350 652 7.0E-06
sp|O94365|UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 516 608 7.0E-06
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 430 608 7.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 302 530 8.0E-06
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 506 652 8.0E-06
sp|Q8BHB4|WDR3_MOUSE WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 516 608 8.0E-06
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 300 385 8.0E-06
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 430 573 8.0E-06
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 501 569 8.0E-06
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 430 573 9.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 303 613 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1883
MADGGFSDVAGPDEDQSIISTRGLEAFGRKVTSTASSLIVPNTESAAMHYQTALAQVHRKLRRPSVQRSVFSMAR
TTPTDMVRARLSPTEIQHRALTRLSDELLANIPEHDNAYSLFQGFQASFPELTDDGKKHRRRVSRGRKLLDDSPM
EGAKSLKRLKKDRAALMHEFELLAIRKNMASSEIRDIDNKLANLQGMRRIILDRLAGLEQDEALMEHDIVEVDGR
LEEAQAMVDEAESIANKAPSKDESELVADADDHDVEFMSQSVYEKLPGSTNSTPSRRQKRVHRRISMPILHEHMD
VGSNLREIRAHRDNITALDFDAPFGTLVTAALDDTVKVWDLTAGRCMGFLEGHTASVRALQVQDNILATGGADAT
IRLWDLSRSQYDPQGDHLGRDAEDEEAIAFENPEDQPVDPPEGSMDDCGLFTLEAHVDEVTALDFRGDVLVSGSA
DKTLRHWDLAKGRCVQTLDVMWAAAQASATSAGDGPWRPTGRPLGGGSGGGNSDFVGALQVFETALACGTADGMV
RLWDLRSGQVHRSLVGHTGPVTSLQFDNVHLVTGSLDRSVRIWDLRTGSIYDAYAYDKAITSMMFDARRITCAAG
EDVVKVYDKVEGRQWDCGAGAEEGRTSAVVERVRVRDGYLVEGRRDGVVGAWTC*
Coding >Ophun1|1883
ATGGCCGACGGCGGCTTCTCAGACGTCGCCGGTCCGGACGAAGACCAGTCCATCATATCTACGCGAGGACTCGAG
GCCTTTGGCCGTAAGGTGACGTCGACGGCCTCGAGCCTCATCGTTCCCAATACCGAGTCCGCTGCCATGCACTAC
CAGACAGCCTTGGCCCAAGTCCATCGCAAGCTTCGACGGCCGTCGGTCCAACGCAGCGTCTTCTCCATGGCACGA
ACCACCCCGACCGACATGGTCCGCGCGCGCCTCTCGCCGACCGAGATTCAGCACCGCGCCCTGACCCGGCTTTCG
GACGAGCTGCTGGCCAATATCCCCGAACACGACAACGCCTACTCGCTCTTCCAGGGCTTCCAGGCCAGCTTTCCC
GAACTCACGGACGATGGCAAGAAACATCGACGTCGCGTCTCGAGGGGCAGGAAACTGCTCGATGACAGTCCGATG
GAGGGGGCAAAGAGCCTGAAGCGTCTAAAAAAGGACAGGGCGGCTTTGATGCACGAGTTTGAGCTGCTCGCCATC
CGCAAGAACATGGCCAGCAGTGAGATTCGCGACATCGACAACAAACTGGCCAACCTGCAAGGCATGCGCCGCATT
ATCCTCGACCGGCTGGCCGGCCTGGAACAGGATGAGGCGCTGATGGAGCACGACATTGTCGAAGTCGACGGGAGG
CTAGAGGAGGCTCAGGCCATGGTCGACGAGGCCGAGAGTATCGCGAACAAGGCGCCGTCGAAAGACGAGTCAGAG
CTCGTCGCAGATGCCGATGACCACGACGTCGAGTTTATGTCGCAGTCTGTCTACGAGAAGCTGCCAGGCTCGACC
AACAGTACGCCATCGCGCCGGCAAAAGCGGGTGCATCGTCGGATATCGATGCCCATATTACACGAGCACATGGAC
GTCGGGTCCAACCTCCGGGAGATTCGAGCGCACCGCGACAACATCACAGCCCTCGACTTTGACGCGCCCTTTGGC
ACTCTGGTGACGGCGGCGCTCGACGACACGGTCAAGGTCTGGGATCTGACGGCTGGGCGGTGCATGGGCTTCCTC
GAGGGCCACACGGCCTCTGTGCGCGCCCTCCAGGTTCAAGACAACATCCTGGCTACGGGCGGTGCCGACGCGACC
ATTCGGCTGTGGGACCTGAGCAGATCACAATACGATCCGCAGGGCGACCATCTGGGCCGTGATGCCGAGGACGAA
GAGGCCATCGCTTTCGAGAACCCGGAAGACCAGCCGGTTGATCCGCCCGAGGGCAGCATGGATGACTGCGGGCTG
TTCACGCTCGAGGCCCACGTGGACGAAGTGACGGCGCTCGACTTCAGGGGGGACGTGCTGGTATCGGGCTCGGCG
GACAAGACGCTGCGGCACTGGGACCTCGCCAAGGGCCGGTGCGTGCAGACGCTCGACGTCATGTGGGCGGCGGCT
CAGGCATCGGCGACGAGCGCCGGCGACGGGCCCTGGAGGCCGACAGGGCGACCCCTGGGAGGCGGAAGCGGCGGC
GGCAATTCGGACTTTGTGGGCGCTCTCCAGGTGTTTGAGACAGCGCTGGCATGCGGGACGGCCGACGGCATGGTC
CGGCTCTGGGACCTCCGGAGTGGACAGGTGCACAGGAGCCTGGTGGGCCACACGGGGCCTGTGACGAGTCTGCAG
TTCGACAACGTCCACCTGGTGACGGGGAGCCTGGACCGGAGCGTGAGAATATGGGATCTACGGACCGGGTCCATC
TATGACGCTTACGCCTACGACAAGGCCATCACGAGCATGATGTTCGACGCAAGGAGGATCACGTGTGCGGCTGGC
GAGGACGTGGTCAAGGTGTACGACAAGGTCGAGGGCCGCCAATGGGACTGCGGAGCTGGAGCCGAGGAGGGAAGG
ACTTCGGCCGTTGTAGAGCGGGTTCGTGTAAGAGACGGGTACCTGGTCGAGGGTCGACGGGATGGTGTCGTGGGA
GCCTGGACGTGCTGA
Transcript >Ophun1|1883
ATGGCCGACGGCGGCTTCTCAGACGTCGCCGGTCCGGACGAAGACCAGTCCATCATATCTACGCGAGGACTCGAG
GCCTTTGGCCGTAAGGTGACGTCGACGGCCTCGAGCCTCATCGTTCCCAATACCGAGTCCGCTGCCATGCACTAC
CAGACAGCCTTGGCCCAAGTCCATCGCAAGCTTCGACGGCCGTCGGTCCAACGCAGCGTCTTCTCCATGGCACGA
ACCACCCCGACCGACATGGTCCGCGCGCGCCTCTCGCCGACCGAGATTCAGCACCGCGCCCTGACCCGGCTTTCG
GACGAGCTGCTGGCCAATATCCCCGAACACGACAACGCCTACTCGCTCTTCCAGGGCTTCCAGGCCAGCTTTCCC
GAACTCACGGACGATGGCAAGAAACATCGACGTCGCGTCTCGAGGGGCAGGAAACTGCTCGATGACAGTCCGATG
GAGGGGGCAAAGAGCCTGAAGCGTCTAAAAAAGGACAGGGCGGCTTTGATGCACGAGTTTGAGCTGCTCGCCATC
CGCAAGAACATGGCCAGCAGTGAGATTCGCGACATCGACAACAAACTGGCCAACCTGCAAGGCATGCGCCGCATT
ATCCTCGACCGGCTGGCCGGCCTGGAACAGGATGAGGCGCTGATGGAGCACGACATTGTCGAAGTCGACGGGAGG
CTAGAGGAGGCTCAGGCCATGGTCGACGAGGCCGAGAGTATCGCGAACAAGGCGCCGTCGAAAGACGAGTCAGAG
CTCGTCGCAGATGCCGATGACCACGACGTCGAGTTTATGTCGCAGTCTGTCTACGAGAAGCTGCCAGGCTCGACC
AACAGTACGCCATCGCGCCGGCAAAAGCGGGTGCATCGTCGGATATCGATGCCCATATTACACGAGCACATGGAC
GTCGGGTCCAACCTCCGGGAGATTCGAGCGCACCGCGACAACATCACAGCCCTCGACTTTGACGCGCCCTTTGGC
ACTCTGGTGACGGCGGCGCTCGACGACACGGTCAAGGTCTGGGATCTGACGGCTGGGCGGTGCATGGGCTTCCTC
GAGGGCCACACGGCCTCTGTGCGCGCCCTCCAGGTTCAAGACAACATCCTGGCTACGGGCGGTGCCGACGCGACC
ATTCGGCTGTGGGACCTGAGCAGATCACAATACGATCCGCAGGGCGACCATCTGGGCCGTGATGCCGAGGACGAA
GAGGCCATCGCTTTCGAGAACCCGGAAGACCAGCCGGTTGATCCGCCCGAGGGCAGCATGGATGACTGCGGGCTG
TTCACGCTCGAGGCCCACGTGGACGAAGTGACGGCGCTCGACTTCAGGGGGGACGTGCTGGTATCGGGCTCGGCG
GACAAGACGCTGCGGCACTGGGACCTCGCCAAGGGCCGGTGCGTGCAGACGCTCGACGTCATGTGGGCGGCGGCT
CAGGCATCGGCGACGAGCGCCGGCGACGGGCCCTGGAGGCCGACAGGGCGACCCCTGGGAGGCGGAAGCGGCGGC
GGCAATTCGGACTTTGTGGGCGCTCTCCAGGTGTTTGAGACAGCGCTGGCATGCGGGACGGCCGACGGCATGGTC
CGGCTCTGGGACCTCCGGAGTGGACAGGTGCACAGGAGCCTGGTGGGCCACACGGGGCCTGTGACGAGTCTGCAG
TTCGACAACGTCCACCTGGTGACGGGGAGCCTGGACCGGAGCGTGAGAATATGGGATCTACGGACCGGGTCCATC
TATGACGCTTACGCCTACGACAAGGCCATCACGAGCATGATGTTCGACGCAAGGAGGATCACGTGTGCGGCTGGC
GAGGACGTGGTCAAGGTGTACGACAAGGTCGAGGGCCGCCAATGGGACTGCGGAGCTGGAGCCGAGGAGGGAAGG
ACTTCGGCCGTTGTAGAGCGGGTTCGTGTAAGAGACGGGTACCTGGTCGAGGGTCGACGGGATGGTGTCGTGGGA
GCCTGGACGTGCTGA
Gene >Ophun1|1883
ATGGCCGACGGCGGCTTCTCAGACGTCGCCGGTCCGGACGAAGACCAGTCCATCATATCTGTACGTCTGTCTATC
GCATCCAAACAACAAGAGTGTTGACCGGGGTCAGACGCGAGGACTCGAGGCCTTTGGCCGTAAGGTGACGTCGAC
GGCCTCGAGCCTCATCGTTCCCAATACCGAGTCCGCTGCCATGCACTACCAGACAGCCTTGGCCCAAGTCCATCG
CAAGCTTCGACGGCCGTCGGTCCAACGCAGCGTCTTCTCCATGGCACGAACCACCCCGACCGACATGGTCCGCGC
GCGCCTCTCGCCGACCGAGATTCAGCACCGCGCCCTGACCCGGCTTTCGGACGAGCTGCTGGCCAATATCCCCGA
ACACGACAACGCCTACTCGCTCTTCCAGGGCTTCCAGGCCAGCTTTCCCGAACTCACGGACGATGGCAAGAAACA
TCGACGTCGCGTCTCGAGGGGCAGGAAACTGCTCGATGACAGTCCGATGGAGGGGGCAAAGAGCCTGAAGCGTCT
AAAAAAGGACAGGGCGGCTTTGATGCACGAGTTTGAGCTGCTCGCCATCCGCAAGAACATGGCCAGCAGTGAGAT
TCGCGACATCGACAACAAACTGGCCAACCTGCAAGGCATGCGCCGCATTATCCTCGACCGGCTGGCCGGCCTGGA
ACAGGATGAGGCGCTGATGGAGCACGACAGTAGGTGTCTCATGCCAGAAATACACCCCCGAAGCCCGACCCCCGT
GCTCATGTCACACCAGTTGTCGAAGTCGACGGGAGGCTAGAGGAGGCTCAGGCCATGGTCGACGAGGCCGAGAGT
ATCGCGAACAAGGCGCCGTCGAAAGACGAGTCAGAGCTCGTCGCAGATGCCGATGACCACGACGTCGAGTTTATG
TCGCAGTCTGTCTACGAGAAGCTGCCAGGCTCGACCAACAGTACGCCATCGCGCCGGCAAAAGCGGGTGCATCGT
CGGATATCGATGCCCATATTACACGAGCACATGGACGTCGGGTCCAACCTCCGGGAGATTCGAGCGCACCGCGAC
AACATCACAGCCCTCGACTTTGACGCGCCCTTTGGCACTCTGGTGACGGCGGCGCTCGACGACACGGTCAAGGTC
TGGGATCTGACGGCTGGGCGGTGCATGGGCTTCCTCGAGGGCCACACGGCCTCTGTGCGCGCCCTCCAGGTTCAA
GACAACATCCTGGCTACGGGCGGTGCCGACGCGACCATTCGGCTGTGGGACCTGAGCAGATCACAATACGATCCG
CAGGGCGACCATCTGGGCCGTGATGCCGAGGACGAAGAGGCCATCGCTTTCGAGAACCCGGAAGACCAGCCGGTT
GATCCGCCCGAGGGCAGCATGGATGACTGCGGGCTGTTCACGCTCGAGGCCCACGTGGACGAAGTGACGGCGCTC
GACTTCAGGGGGGACGTGCTGGTATCGGGCTCGGCGGACAAGACGCTGCGGCACTGGGACCTCGCCAAGGGCCGG
TGCGTGCAGACGCTCGACGTCATGTGGGCGGCGGCTCAGGCATCGGCGACGAGCGCCGGCGACGGGCCCTGGAGG
CCGACAGGGCGACCCCTGGGAGGCGGAAGCGGCGGCGGCAATTCGGACTTTGTGGGCGCTCTCCAGGTGTTTGAG
ACAGCGCTGGCATGCGGGACGGCCGACGGCATGGTCCGGCTCTGGGACCTCCGGAGTGGACAGGTGCACAGGAGC
CTGGTGGGCCACACGGGGCCTGTGACGAGTCTGCAGTTCGACAACGTCCACCTGGTGACGGGGAGCCTGGACCGG
AGCGTGAGAGTGAGTTGTGACGACGGGTGGCGTTATCCCATAAGCGGCTGACCAGTCCCAGATATGGGATCTACG
GACCGGGTCCATCTATGACGCTTACGCCTACGACAAGGCCATCACGAGCATGATGTTCGACGCAAGGAGGATCAC
GTGTGCGGCTGGCGAGGACGTGGTCAAGGTGTACGACAAGGTCGAGGGCCGCCAATGGGACTGCGGAGCTGGAGC
CGAGGAGGGAAGGACTTCGGCCGTTGTAGAGCGGGTTCGTGTAAGAGACGGGTACCTGGTCGAGGGTCGACGGGA
TGGTGTCGTGGGAGCCTGGACGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail