Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1882
Gene name
LocationContig_184:14338..15306
Strand-
Gene length (bp)968
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32178|CHMU_YEAST Chorismate mutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO7 PE=1 SV=1 12 261 6.0E-75
sp|O13739|CHMU_SCHPO Probable chorismate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.04c PE=3 SV=1 15 260 2.0E-67
sp|P42738|CM1_ARATH Chorismate mutase 1, chloroplastic OS=Arabidopsis thaliana GN=CM1 PE=1 SV=3 15 261 7.0E-56
sp|Q9C544|CM3_ARATH Chorismate mutase 3, chloroplastic OS=Arabidopsis thaliana GN=CM3 PE=1 SV=1 15 261 1.0E-53
sp|Q9S7H4|CM2_ARATH Chorismate mutase 2 OS=Arabidopsis thaliana GN=CM2 PE=1 SV=1 6 261 3.0E-51

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1882
MDSAVDMADAGHNLLDLSQIRLQLIRLEDTITFHLIERVRFALNKTIYVPGAIGIPDSDLSFFDWYLREQEKLQS
LIRRFDSPDEYPFFPDAVRTPILRPLDYPRILHPNNVNINAKIKSFYIDKFLPAVCPDFGREDRGESQENYGSTA
TCDIACLQALSRRIHFGKFVAETKFRSERDAYTRMIKAADREGIARSITNDAVELKILERLRLKALTYGKDPAGH
QSPVKIDVDAVVAMYKDFVIPLTKEVEVEYLMQRLEPER*
Coding >Ophun1|1882
ATGGACTCGGCCGTCGATATGGCCGACGCCGGCCACAATCTGCTGGATCTGTCGCAGATTCGCCTCCAGTTAATA
CGCTTAGAAGATACCATAACCTTTCATCTCATCGAGAGGGTCCGATTTGCCCTCAACAAGACCATCTACGTCCCC
GGGGCCATTGGCATTCCCGATAGCGACCTCAGCTTCTTCGACTGGTACCTGCGCGAGCAAGAAAAGCTGCAGTCG
CTGATCCGACGCTTCGACTCACCAGACGAGTATCCCTTCTTCCCCGACGCCGTGCGGACGCCCATCCTCAGGCCT
CTCGACTACCCCAGGATCCTGCATCCCAACAACGTCAACATCAACGCCAAGATCAAATCGTTCTACATTGACAAA
TTCTTGCCCGCCGTCTGTCCCGACTTCGGACGCGAGGACCGGGGAGAGTCGCAGGAAAACTACGGCTCGACGGCG
ACGTGCGACATCGCCTGCCTCCAGGCCCTGTCCCGCCGCATACACTTTGGCAAATTCGTGGCCGAGACCAAGTTT
CGATCCGAACGCGATGCCTACACTCGCATGATCAAGGCTGCCGACCGCGAGGGCATCGCCCGCTCCATTACCAAT
GACGCAGTCGAGTTGAAGATTCTCGAGCGCCTCCGTCTCAAGGCCCTGACCTACGGCAAGGACCCGGCCGGGCAC
CAAAGTCCCGTCAAGATCGACGTCGACGCCGTCGTGGCCATGTACAAGGACTTTGTCATTCCCTTGACCAAGGAG
GTCGAGGTTGAGTACTTGATGCAGAGGCTGGAACCGGAACGCTGA
Transcript >Ophun1|1882
ATGGACTCGGCCGTCGATATGGCCGACGCCGGCCACAATCTGCTGGATCTGTCGCAGATTCGCCTCCAGTTAATA
CGCTTAGAAGATACCATAACCTTTCATCTCATCGAGAGGGTCCGATTTGCCCTCAACAAGACCATCTACGTCCCC
GGGGCCATTGGCATTCCCGATAGCGACCTCAGCTTCTTCGACTGGTACCTGCGCGAGCAAGAAAAGCTGCAGTCG
CTGATCCGACGCTTCGACTCACCAGACGAGTATCCCTTCTTCCCCGACGCCGTGCGGACGCCCATCCTCAGGCCT
CTCGACTACCCCAGGATCCTGCATCCCAACAACGTCAACATCAACGCCAAGATCAAATCGTTCTACATTGACAAA
TTCTTGCCCGCCGTCTGTCCCGACTTCGGACGCGAGGACCGGGGAGAGTCGCAGGAAAACTACGGCTCGACGGCG
ACGTGCGACATCGCCTGCCTCCAGGCCCTGTCCCGCCGCATACACTTTGGCAAATTCGTGGCCGAGACCAAGTTT
CGATCCGAACGCGATGCCTACACTCGCATGATCAAGGCTGCCGACCGCGAGGGCATCGCCCGCTCCATTACCAAT
GACGCAGTCGAGTTGAAGATTCTCGAGCGCCTCCGTCTCAAGGCCCTGACCTACGGCAAGGACCCGGCCGGGCAC
CAAAGTCCCGTCAAGATCGACGTCGACGCCGTCGTGGCCATGTACAAGGACTTTGTCATTCCCTTGACCAAGGAG
GTCGAGGTTGAGTACTTGATGCAGAGGCTGGAACCGGAACGCTGA
Gene >Ophun1|1882
ATGGACTCGGCCGTCGATATGGCCGACGCCGGCCACAATCTGCTGGATCTGTCGCAGATTCGCCTCCAGTTAATG
TAAAATGAAACGACTCCATCCTCAACAAAGGGGGATCGACCCGAGGCATACGAGCGTCCTTTGCGATATCAGCAT
GGCCAGGGACAGCCCCCGGCGTGGCAGCTTGCTGATGGTCTGCGCAGACGCTTAGAAGATACCATAACCTTTCAT
CTCATCGAGAGGGTCCGATTTGCCCTCAACAAGGTATCGTCGACGCCTCTCCTCCCTCAGCCATCTCACGCTCAT
AATGGCAGACCATCTACGTCCCCGGGGCCATTGGCATTCCCGATAGCGACCTCAGCTTCTTCGACTGGTACCTGC
GCGAGCAAGAAAAGCTGCAGTCGCTGATCCGACGCTTCGACTCACCAGACGAGTATCCCTTCTTCCCCGACGCCG
TGCGGACGCCCATCCTCAGGCCTCTCGACTACCCCAGGATCCTGCATCCCAACAACGTCAACATCAACGCCAAGA
TCAAATCGTTCTACATTGACAAATTCTTGCCCGCCGTCTGTCCCGACTTCGGACGCGAGGACCGGGGAGAGTCGC
AGGAAAACTACGGCTCGACGGCGACGTGCGACATCGCCTGCCTCCAGGCCCTGTCCCGCCGCATACACTTTGGCA
AATTCGTGGCCGAGACCAAGTTTCGATCCGAACGCGATGCCTACACTCGCATGATCAAGGCTGCCGACCGCGAGG
GCATCGCCCGCTCCATTACCAATGACGCAGTCGAGTTGAAGATTCTCGAGCGCCTCCGTCTCAAGGCCCTGACCT
ACGGCAAGGACCCGGCCGGGCACCAAAGTCCCGTCAAGATCGACGTCGACGCCGTCGTGGCCATGTACAAGGACT
TTGTCATTCCCTTGACCAAGGAGGTCGAGGTTGAGTACTTGATGCAGAGGCTGGAACCGGAACGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail