Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1881
Gene name
LocationContig_184:13387..14299
Strand+
Gene length (bp)912
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13862 BCCIP BCCIP 3.3E-66 51 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZK7|BCP1_GIBZE Protein BCP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BCP1 PE=3 SV=1 1 303 4.0E-139
sp|Q2H137|BCP1_CHAGB Protein BCP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BCP1 PE=3 SV=1 1 299 1.0E-111
sp|Q4WVS2|BCP1_ASPFU Protein bcp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bcp1 PE=3 SV=2 50 302 5.0E-98
sp|Q7S8R3|BCP1_NEUCR Protein bcp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bcp-1 PE=3 SV=1 1 299 3.0E-96
sp|Q5AXW5|BCP1_EMENI Protein bcp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bcp1 PE=3 SV=1 39 303 2.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZK7|BCP1_GIBZE Protein BCP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BCP1 PE=3 SV=1 1 303 4.0E-139
sp|Q2H137|BCP1_CHAGB Protein BCP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BCP1 PE=3 SV=1 1 299 1.0E-111
sp|Q4WVS2|BCP1_ASPFU Protein bcp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bcp1 PE=3 SV=2 50 302 5.0E-98
sp|Q7S8R3|BCP1_NEUCR Protein bcp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bcp-1 PE=3 SV=1 1 299 3.0E-96
sp|Q5AXW5|BCP1_EMENI Protein bcp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bcp1 PE=3 SV=1 39 303 2.0E-93
sp|Q2U600|BCP1_ASPOR Protein bcp1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bcp1 PE=3 SV=1 45 302 1.0E-89
sp|O74907|BCP1_SCHPO Protein bcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bcp1 PE=3 SV=2 48 292 1.0E-61
sp|Q6C7K5|BCP1_YARLI Protein BCP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BCP1 PE=3 SV=1 50 292 9.0E-61
sp|Q6BII5|BCP1_DEBHA Protein BCP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BCP1 PE=3 SV=1 50 301 1.0E-52
sp|Q59PE7|BCP1_CANAL Protein BCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCP1 PE=3 SV=1 50 302 6.0E-49
sp|Q6FY61|BCP1_CANGA Protein BCP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BCP1 PE=3 SV=1 50 250 1.0E-34
sp|Q756K9|BCP1_ASHGO Protein BCP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BCP1 PE=3 SV=1 48 247 2.0E-31
sp|Q06338|BCP1_YEAST Protein BCP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCP1 PE=1 SV=1 51 250 3.0E-31
sp|Q9CWI3|BCCIP_MOUSE BRCA2 and CDKN1A-interacting protein OS=Mus musculus GN=Bccip PE=1 SV=1 53 299 3.0E-20
sp|Q4PA45|BCP1_USTMA Protein BCP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BCP1 PE=3 SV=1 50 210 3.0E-20
sp|Q2NL37|BCCIP_BOVIN BRCA2 and CDKN1A-interacting protein OS=Bos taurus GN=BCCIP PE=2 SV=1 53 299 1.0E-19
sp|Q9P287|BCCIP_HUMAN BRCA2 and CDKN1A-interacting protein OS=Homo sapiens GN=BCCIP PE=1 SV=1 53 299 3.0E-19
sp|O64885|BCCIP_ARATH Protein BCCIP homolog OS=Arabidopsis thaliana GN=At2g44510 PE=1 SV=2 52 299 4.0E-19
sp|Q5BJJ7|BCCIP_DANRE Protein BCCIP homolog OS=Danio rerio GN=bccip PE=2 SV=1 66 299 2.0E-18
sp|Q6GNI0|BCCIP_XENLA Protein BCCIP homolog OS=Xenopus laevis GN=bccip PE=2 SV=1 86 299 7.0E-16
sp|Q6GL92|BCCIP_XENTR Protein BCCIP homolog OS=Xenopus tropicalis GN=bccip PE=2 SV=1 86 299 3.0E-15
sp|Q9VFR0|BCCIP_DROME Protein BCCIP homolog OS=Drosophila melanogaster GN=CG9286 PE=2 SV=2 52 299 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1881
MGKKRARDEAKNLPSGEQDADQIDRDDDVRPVIRSRLMPTLTLATQDDFDMVDVEFEWFNFDPEIDFHGVKSLIR
QLLDVDASLFDMSALAELVLSQPTIGSTVKVDGKATDPYAMLTVLNMREHRQKEPMKRLMAYLVEKARANKAISA
IADAIDADKQIGLILSERLINVPPEIGPPMYSMLVDEVEAAVEDREPYQFSHYLVLSKTYREIESTLDVEDRKRK
KAREDSTTYYFHPEDEILHKHAAAHGGFAYTKEEDAVADSKRAFQDMGIKPAGHMILIEADKFESAVKAINDYLK
PPQ*
Coding >Ophun1|1881
ATGGGCAAGAAGCGGGCGAGAGACGAGGCCAAGAATCTTCCCTCGGGAGAGCAAGATGCCGACCAGATAGACCGC
GACGACGATGTGAGACCCGTTATCAGATCCCGTTTAATGCCCACGCTCACCTTGGCAACGCAGGATGACTTCGAT
ATGGTCGACGTCGAGTTCGAATGGTTCAATTTTGATCCCGAGATCGACTTTCACGGCGTAAAGTCCCTCATCCGG
CAGCTTCTCGACGTCGACGCCAGCCTCTTCGACATGTCCGCCCTCGCCGAGCTGGTGCTGTCCCAGCCCACAATC
GGGTCGACGGTCAAGGTCGACGGCAAGGCTACCGATCCATACGCCATGCTCACCGTCCTCAATATGCGCGAGCAC
CGCCAGAAAGAGCCCATGAAGCGTCTGATGGCATACCTCGTGGAAAAGGCGCGCGCCAACAAGGCCATATCTGCC
ATCGCCGACGCGATAGATGCCGACAAGCAGATCGGGCTGATTCTCTCGGAACGCCTGATCAATGTGCCGCCCGAG
ATCGGTCCCCCCATGTACTCGATGCTTGTGGACGAGGTCGAAGCCGCCGTGGAGGACCGGGAGCCCTACCAGTTC
AGCCACTACCTCGTCTTGTCCAAGACGTATCGCGAGATAGAGTCGACATTGGACGTTGAGGATCGCAAGCGCAAA
AAGGCCCGCGAGGACTCAACTACGTACTACTTTCACCCCGAAGACGAGATACTCCACAAGCACGCCGCCGCGCAT
GGCGGTTTTGCCTACACCAAGGAGGAGGACGCGGTCGCGGACAGCAAGCGCGCGTTCCAGGACATGGGCATCAAG
CCGGCTGGTCACATGATTCTCATTGAGGCGGACAAGTTTGAGAGTGCCGTCAAAGCAATCAACGACTATCTGAAG
CCGCCGCAATAA
Transcript >Ophun1|1881
ATGGGCAAGAAGCGGGCGAGAGACGAGGCCAAGAATCTTCCCTCGGGAGAGCAAGATGCCGACCAGATAGACCGC
GACGACGATGTGAGACCCGTTATCAGATCCCGTTTAATGCCCACGCTCACCTTGGCAACGCAGGATGACTTCGAT
ATGGTCGACGTCGAGTTCGAATGGTTCAATTTTGATCCCGAGATCGACTTTCACGGCGTAAAGTCCCTCATCCGG
CAGCTTCTCGACGTCGACGCCAGCCTCTTCGACATGTCCGCCCTCGCCGAGCTGGTGCTGTCCCAGCCCACAATC
GGGTCGACGGTCAAGGTCGACGGCAAGGCTACCGATCCATACGCCATGCTCACCGTCCTCAATATGCGCGAGCAC
CGCCAGAAAGAGCCCATGAAGCGTCTGATGGCATACCTCGTGGAAAAGGCGCGCGCCAACAAGGCCATATCTGCC
ATCGCCGACGCGATAGATGCCGACAAGCAGATCGGGCTGATTCTCTCGGAACGCCTGATCAATGTGCCGCCCGAG
ATCGGTCCCCCCATGTACTCGATGCTTGTGGACGAGGTCGAAGCCGCCGTGGAGGACCGGGAGCCCTACCAGTTC
AGCCACTACCTCGTCTTGTCCAAGACGTATCGCGAGATAGAGTCGACATTGGACGTTGAGGATCGCAAGCGCAAA
AAGGCCCGCGAGGACTCAACTACGTACTACTTTCACCCCGAAGACGAGATACTCCACAAGCACGCCGCCGCGCAT
GGCGGTTTTGCCTACACCAAGGAGGAGGACGCGGTCGCGGACAGCAAGCGCGCGTTCCAGGACATGGGCATCAAG
CCGGCTGGTCACATGATTCTCATTGAGGCGGACAAGTTTGAGAGTGCCGTCAAAGCAATCAACGACTATCTGAAG
CCGCCGCAATAA
Gene >Ophun1|1881
ATGGGCAAGAAGCGGGCGAGAGACGAGGCCAAGAATCTTCCCTCGGGAGAGCAAGATGCCGACCAGATAGACCGC
GACGACGATGTGAGACCCGTTATCAGATCCCGTTTAATGCCCACGCTCACCTTGGCAACGCAGGATGACTTCGAT
ATGGTCGACGTCGAGTTCGAATGGTTCAATTTTGATCCCGAGATCGACTTTCACGGCGTAAAGTCCCTCATCCGG
CAGCTTCTCGACGTCGACGCCAGCCTCTTCGACATGTCCGCCCTCGCCGAGCTGGTGCTGTCCCAGCCCACAATC
GGGTCGACGGTCAAGGTCGACGGCAAGGCTACCGATCCATACGCCATGCTCACCGTCCTCAATATGCGCGAGCAC
CGCCAGAAAGAGCCCATGAAGCGTCTGATGGCATACCTCGTGGAAAAGGCGCGCGCCAACAAGGCCATATCTGCC
ATCGCCGACGCGATAGATGCCGACAAGCAGATCGGGCTGATTCTCTCGGAACGCCTGATCAATGTGCCGCCCGAG
ATCGGTCCCCCCATGTACTCGATGCTTGTGGACGAGGTCGAAGCCGCCGTGGAGGACCGGGAGCCCTACCAGTTC
AGCCACTACCTCGTCTTGTCCAAGACGTATCGCGAGATAGAGTCGACATTGGACGTTGAGGATCGCAAGCGCAAA
AAGGCCCGCGAGGACTCAACTACGTACTACTTTCACCCCGAAGACGAGATACTCCACAAGCACGCCGCCGCGCAT
GGCGGTTTTGCCTACACCAAGGAGGAGGACGCGGTCGCGGACAGCAAGCGCGCGTTCCAGGACATGGGCATCAAG
CCGGCTGGTCACATGATTCTCATTGAGGCGGACAAGTTTGAGAGTGCCGTCAAAGCAATCAACGACTATCTGAAG
CCGCCGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail