Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1880
Gene name
LocationContig_184:11049..12956
Strand-
Gene length (bp)1907
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00787 PX PX domain 1.8E-07 167 247
PF09325 Vps5 Vps5 C terminal like 2.4E-07 302 487

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URW7|VPS17_SCHPO Vacuolar protein sorting-associated protein 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps17 PE=3 SV=1 135 535 2.0E-108
sp|P32913|VPS17_YEAST Vacuolar protein sorting-associated protein 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS17 PE=1 SV=2 58 598 8.0E-90

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1880
MDYSASIHEADDPAGVSPWGNSPISSPQNQSGFENMAAAANDPPPFPFSPQSPNGLGQTEGFQPPATASKDPATA
QPETEATASTVPEATVASPEGSADHLPGAIPSPKSPEDTSAPLLQPTSAKQPQKPSAPQPRLQAKITGLERTGKK
DPILRFDIHTNLPRFRTTQYRDVRRLHSEFVKLADHLISANPEALVPAVPPPVTAAGAGTEEDENRVKSTMQRWF
NYVSNNEVLMKDDEMILFVESDFGYSPMVKMKQPATGVRRKILKQFAPPPDDTPELASARPTVKLFYLGTMDAGH
KVDKMVKARRGLGLAESDFGVKLGTMHVQEPHPGLAHAFRKLGKIIQTVGDYHAAQATAEAATIGDAFQYHSQDS
FIVKESLTNRQILTREFLQAQEATRSRLNAADRLKASSSVRRDKVDEAIAALDEARQTETALFAKTTRVTHNLVL
ERRKWFSRTAIDLRLALRDYVLRQIEAERRTLAVLETVRPDIRSIDASGGLSRLGRESTPRAAVRRTSLAASQGP
KGDAWSGVPRRSDASSRAVSGSFMGRLPEETEGEGGEAGLAASGLLLSPGGVNEDDEDRIDARNAASRLATSTF*
Coding >Ophun1|1880
ATGGACTATAGCGCCTCCATCCACGAGGCGGACGACCCTGCCGGCGTCTCTCCTTGGGGAAATTCTCCCATCTCG
TCACCGCAGAATCAGTCTGGCTTCGAGAACATGGCTGCTGCTGCCAACGACCCGCCGCCGTTTCCCTTCTCGCCT
CAGTCTCCAAATGGCCTCGGCCAGACAGAAGGCTTCCAGCCCCCAGCAACGGCCAGCAAGGATCCTGCGACTGCG
CAGCCCGAAACAGAGGCTACGGCTTCTACGGTCCCGGAAGCGACTGTTGCGTCGCCAGAGGGGAGCGCCGACCAC
CTCCCGGGCGCAATTCCATCGCCAAAGTCGCCCGAGGACACCTCTGCGCCTCTCTTGCAACCGACGAGCGCAAAG
CAGCCGCAAAAGCCGTCTGCTCCCCAGCCGAGACTCCAAGCAAAGATAACAGGTCTTGAGCGCACCGGCAAGAAG
GATCCAATCCTCCGCTTCGACATTCACACGAACCTCCCTCGATTTCGCACCACGCAGTACCGAGATGTCCGTCGT
CTACACTCCGAGTTTGTCAAGCTGGCCGATCACTTGATATCAGCCAATCCCGAAGCTCTGGTTCCCGCCGTGCCG
CCTCCCGTCACAGCAGCCGGAGCCGGCACCGAGGAAGACGAGAATCGGGTCAAGTCGACGATGCAGCGATGGTTC
AACTACGTGTCCAACAATGAGGTCCTGATGAAGGACGACGAAATGATTCTCTTCGTAGAGAGCGACTTTGGCTAC
AGCCCCATGGTCAAGATGAAGCAGCCGGCGACAGGCGTCCGACGCAAGATCCTGAAGCAGTTTGCGCCGCCCCCA
GACGACACCCCTGAGCTCGCTTCGGCCCGTCCGACCGTCAAGCTGTTCTATCTAGGCACCATGGACGCAGGCCAC
AAGGTCGACAAGATGGTCAAGGCCCGAAGAGGACTCGGCCTCGCAGAATCCGACTTTGGCGTCAAGCTGGGAACC
ATGCACGTCCAAGAGCCTCATCCAGGCCTCGCGCACGCCTTCCGCAAGCTGGGCAAGATTATCCAAACAGTAGGC
GACTACCACGCAGCACAAGCAACCGCCGAAGCCGCAACGATAGGCGACGCCTTCCAATACCACTCGCAGGATTCC
TTCATCGTAAAGGAATCCCTCACAAACCGACAGATCCTCACCCGCGAATTCCTCCAAGCGCAAGAGGCAACCCGC
TCCCGACTCAACGCGGCAGACCGCCTCAAAGCCAGCTCCAGCGTCCGCCGCGACAAGGTAGACGAAGCCATCGCC
GCCCTCGACGAAGCCCGCCAAACAGAAACAGCCCTCTTCGCAAAGACGACGCGCGTAACGCACAACCTCGTCCTC
GAACGTCGCAAGTGGTTCTCCCGCACCGCCATAGACCTCCGCCTCGCCCTCCGCGATTACGTCCTCCGCCAAATC
GAAGCCGAGCGCCGCACCCTCGCCGTCCTCGAAACCGTCCGCCCCGACATCCGCTCCATCGACGCCTCGGGCGGT
CTCAGCCGTCTCGGCCGCGAGTCCACCCCGCGAGCCGCCGTCCGACGCACCAGCCTAGCCGCCAGCCAGGGCCCC
AAGGGCGACGCCTGGAGCGGTGTGCCCCGCCGGTCCGATGCTTCCAGCCGCGCCGTCTCGGGCAGCTTCATGGGG
AGGCTTCCTGAGGAGACCGAGGGGGAGGGCGGGGAGGCTGGGCTTGCGGCTTCGGGGCTGCTGCTTAGTCCGGGG
GGTGTCAATGAGGATGATGAGGATCGTATTGATGCTAGGAACGCGGCTAGTCGTCTGGCGACGAGTACTTTTTGA
Transcript >Ophun1|1880
ATGGACTATAGCGCCTCCATCCACGAGGCGGACGACCCTGCCGGCGTCTCTCCTTGGGGAAATTCTCCCATCTCG
TCACCGCAGAATCAGTCTGGCTTCGAGAACATGGCTGCTGCTGCCAACGACCCGCCGCCGTTTCCCTTCTCGCCT
CAGTCTCCAAATGGCCTCGGCCAGACAGAAGGCTTCCAGCCCCCAGCAACGGCCAGCAAGGATCCTGCGACTGCG
CAGCCCGAAACAGAGGCTACGGCTTCTACGGTCCCGGAAGCGACTGTTGCGTCGCCAGAGGGGAGCGCCGACCAC
CTCCCGGGCGCAATTCCATCGCCAAAGTCGCCCGAGGACACCTCTGCGCCTCTCTTGCAACCGACGAGCGCAAAG
CAGCCGCAAAAGCCGTCTGCTCCCCAGCCGAGACTCCAAGCAAAGATAACAGGTCTTGAGCGCACCGGCAAGAAG
GATCCAATCCTCCGCTTCGACATTCACACGAACCTCCCTCGATTTCGCACCACGCAGTACCGAGATGTCCGTCGT
CTACACTCCGAGTTTGTCAAGCTGGCCGATCACTTGATATCAGCCAATCCCGAAGCTCTGGTTCCCGCCGTGCCG
CCTCCCGTCACAGCAGCCGGAGCCGGCACCGAGGAAGACGAGAATCGGGTCAAGTCGACGATGCAGCGATGGTTC
AACTACGTGTCCAACAATGAGGTCCTGATGAAGGACGACGAAATGATTCTCTTCGTAGAGAGCGACTTTGGCTAC
AGCCCCATGGTCAAGATGAAGCAGCCGGCGACAGGCGTCCGACGCAAGATCCTGAAGCAGTTTGCGCCGCCCCCA
GACGACACCCCTGAGCTCGCTTCGGCCCGTCCGACCGTCAAGCTGTTCTATCTAGGCACCATGGACGCAGGCCAC
AAGGTCGACAAGATGGTCAAGGCCCGAAGAGGACTCGGCCTCGCAGAATCCGACTTTGGCGTCAAGCTGGGAACC
ATGCACGTCCAAGAGCCTCATCCAGGCCTCGCGCACGCCTTCCGCAAGCTGGGCAAGATTATCCAAACAGTAGGC
GACTACCACGCAGCACAAGCAACCGCCGAAGCCGCAACGATAGGCGACGCCTTCCAATACCACTCGCAGGATTCC
TTCATCGTAAAGGAATCCCTCACAAACCGACAGATCCTCACCCGCGAATTCCTCCAAGCGCAAGAGGCAACCCGC
TCCCGACTCAACGCGGCAGACCGCCTCAAAGCCAGCTCCAGCGTCCGCCGCGACAAGGTAGACGAAGCCATCGCC
GCCCTCGACGAAGCCCGCCAAACAGAAACAGCCCTCTTCGCAAAGACGACGCGCGTAACGCACAACCTCGTCCTC
GAACGTCGCAAGTGGTTCTCCCGCACCGCCATAGACCTCCGCCTCGCCCTCCGCGATTACGTCCTCCGCCAAATC
GAAGCCGAGCGCCGCACCCTCGCCGTCCTCGAAACCGTCCGCCCCGACATCCGCTCCATCGACGCCTCGGGCGGT
CTCAGCCGTCTCGGCCGCGAGTCCACCCCGCGAGCCGCCGTCCGACGCACCAGCCTAGCCGCCAGCCAGGGCCCC
AAGGGCGACGCCTGGAGCGGTGTGCCCCGCCGGTCCGATGCTTCCAGCCGCGCCGTCTCGGGCAGCTTCATGGGG
AGGCTTCCTGAGGAGACCGAGGGGGAGGGCGGGGAGGCTGGGCTTGCGGCTTCGGGGCTGCTGCTTAGTCCGGGG
GGTGTCAATGAGGATGATGAGGATCGTATTGATGCTAGGAACGCGGCTAGTCGTCTGGCGACGAGTACTTTTTGA
Gene >Ophun1|1880
ATGGACTATAGCGCCTCCATCCACGAGGCGGACGACCCTGCCGGCGTCTCTCCTTGGGGAAATTCTCCCATCTCG
TCACCGCAGAATCAGTCTGGCTTCGAGAACATGGCTGCTGCTGCCAACGACCCGCCGCCGTTTCCCTTCTCGCCT
CAGTCTCCAAATGGCCTCGGCCAGACAGAAGGCTTCCAGCCCCCAGCAACGGCCAGCAAGGATCCTGCGACTGCG
CAGCCCGAAACAGAGGCTACGGCTTCTACGGTCCCGGAAGCGACTGTTGCGTCGCCAGAGGGGAGCGCCGACCAC
CTCCCGGGCGCAATTCCATCGCCAAAGTCGCCCGAGGACACCTCTGCGCCTCTCTTGCAACCGACGAGCGCAAAG
CAGCCGCAAAAGCCGTCTGCTCCCCAGCCGAGACTCCAAGCAAAGATAACAGGTCTTGAGCGCACCGGCAAGAAG
GATCCAATCCTCCGCTTCGACATTCACGTACGGTCCGAGATTACGAGCTGCGAAATAACGCATACACTGACAATT
GATAGACGAACCTCCCTCGATTTCGCACCACGCAGTACCGAGATGTCCGTCGTCTACACTCCGAGTTTGTCAAGC
TGGCCGATCACTTGATATCAGCCAATCCCGAAGCTCTGGTTCCCGCCGTGCCGCCTCCCGTCACAGCAGCCGGAG
CCGGCACCGAGGAAGACGAGAATCGGGTCAAGTCGACGATGCAGCGATGGTTCAACTACGTGTCCAACAATGAGG
TCCTGATGAAGGACGACGAAATGATTCTCTTCGTAGAGAGCGACTTTGGCTACAGCCCCATGGTCAAGATGAAGC
AGCCGGCGACAGGCGTCCGACGCAAGATCCTGAAGCAGTTTGCGCCGCCCCCAGACGACACCCCTGAGCTCGCTT
CGGCCCGTCCGACCGTCAAGCTGTTCTATCTAGGCACCATGGACGCAGGCCACAAGGTCGACAAGATGGTCAAGG
CCCGAAGAGGTATGACCGCATCGCCGCAAACTAGACTTGACTCCATCTGACAGGAACACGCAGGACTCGGCCTCG
CAGAATCCGACTTTGGCGTCAAGCTGGGAACCATGCACGTCCAAGAGCCTCATCCAGGCCTCGCGCACGCCTTCC
GCAAGCTGGGCAAGATTATCCAAACAGTAGGCGACTACCACGCAGCACAAGCAACCGCCGAAGCCGCAACGATAG
GCGACGCCTTCCAATACCACTCGCAGGATTCCTTCATCGTAAAGGAATCCCTCACAAACCGACAGATCCTCACCC
GCGAATTCCTCCAAGCGCAAGAGGCAACCCGCTCCCGACTCAACGCGGCAGACCGCCTCAAAGCCAGCTCCAGCG
TCCGCCGCGACAAGGTAGACGAAGCCATCGCCGCCCTCGACGAAGCCCGCCAAACAGAAACAGCCCTCTTCGCAA
AGACGACGCGCGTAACGCACAACCTCGTCCTCGAACGTCGCAAGTGGTTCTCCCGCACCGCCATAGACCTCCGCC
TCGCCCTCCGCGATTACGTCCTCCGCCAAATCGAAGCCGAGCGCCGCACCCTCGCCGTCCTCGAAACCGTCCGCC
CCGACATCCGCTCCATCGACGCCTCGGGCGGTCTCAGCCGTCTCGGCCGCGAGTCCACCCCGCGAGCCGCCGTCC
GACGCACCAGCCTAGCCGCCAGCCAGGGCCCCAAGGGCGACGCCTGGAGCGGTGTGCCCCGCCGGTCCGATGCTT
CCAGCCGCGCCGTCTCGGGCAGCTTCATGGGGAGGCTTCCTGAGGAGACCGAGGGGGAGGGCGGGGAGGCTGGGC
TTGCGGCTTCGGGGCTGCTGCTTAGTCCGGGGGGTGTCAATGAGGATGATGAGGATCGTATTGATGCTAGGAACG
CGGCTAGTCGTCTGGCGACGAGTACTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail