Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|188
Gene name
LocationContig_103:27374..29668
Strand+
Gene length (bp)2294
Transcript length (bp)2244
Coding sequence length (bp)2244
Protein length (aa) 748

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08145 BOP1NT BOP1NT (NUC169) domain 3.6E-103 129 392
PF00400 WD40 WD domain, G-beta repeat 3.2E-12 395 430
PF00400 WD40 WD domain, G-beta repeat 1.2E-05 707 746

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZXX9|BOP1B_XENLA Ribosome biogenesis protein bop1-B OS=Xenopus laevis GN=bop1-b PE=2 SV=1 45 747 0.0E+00
sp|A3LXF0|ERB1_PICST Ribosome biogenesis protein ERB1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ERB1 PE=3 SV=3 92 747 0.0E+00
sp|A5DBG1|ERB1_PICGU Ribosome biogenesis protein ERB1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ERB1 PE=3 SV=2 92 747 0.0E+00
sp|Q6CIH3|ERB1_KLULA Ribosome biogenesis protein ERB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERB1 PE=3 SV=1 87 747 0.0E+00
sp|A5DWF4|ERB1_LODEL Ribosome biogenesis protein ERB1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ERB1 PE=3 SV=1 87 747 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZXX9|BOP1B_XENLA Ribosome biogenesis protein bop1-B OS=Xenopus laevis GN=bop1-b PE=2 SV=1 45 747 0.0E+00
sp|A3LXF0|ERB1_PICST Ribosome biogenesis protein ERB1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ERB1 PE=3 SV=3 92 747 0.0E+00
sp|A5DBG1|ERB1_PICGU Ribosome biogenesis protein ERB1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ERB1 PE=3 SV=2 92 747 0.0E+00
sp|Q6CIH3|ERB1_KLULA Ribosome biogenesis protein ERB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERB1 PE=3 SV=1 87 747 0.0E+00
sp|A5DWF4|ERB1_LODEL Ribosome biogenesis protein ERB1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ERB1 PE=3 SV=1 87 747 0.0E+00
sp|Q59VP7|ERB1_CANAL Ribosome biogenesis protein ERB1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERB1 PE=3 SV=1 92 747 0.0E+00
sp|P0CS35|ERB1_CRYNB Ribosome biogenesis protein ERB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERB1 PE=3 SV=1 99 747 0.0E+00
sp|P0CS34|ERB1_CRYNJ Ribosome biogenesis protein ERB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERB1 PE=3 SV=1 99 747 0.0E+00
sp|O74399|ERB1_SCHPO Ribosome biogenesis protein erb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erb1 PE=1 SV=2 129 747 0.0E+00
sp|A8QD31|ERB1_MALGO Ribosome biogenesis protein ERB1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=ERB1 PE=3 SV=2 72 746 0.0E+00
sp|A8NWR2|ERB1_COPC7 Ribosome biogenesis protein ERB1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ERB1 PE=3 SV=2 91 747 0.0E+00
sp|Q6C4I9|ERB1_YARLI Ribosome biogenesis protein ERB1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERB1 PE=3 SV=1 92 747 0.0E+00
sp|P97452|BOP1_MOUSE Ribosome biogenesis protein BOP1 OS=Mus musculus GN=Bop1 PE=1 SV=1 119 747 0.0E+00
sp|Q7T0W1|BOP1A_XENLA Ribosome biogenesis protein bop1-A OS=Xenopus laevis GN=bop1-a PE=2 SV=1 107 747 0.0E+00
sp|A0JMQ0|BOP1_DANRE Ribosome biogenesis protein bop1 OS=Danio rerio GN=bop1 PE=2 SV=1 107 747 0.0E+00
sp|Q562C2|BOP1_RAT Ribosome biogenesis protein BOP1 OS=Rattus norvegicus GN=Bop1 PE=1 SV=1 119 747 0.0E+00
sp|A4IHS2|BOP1_XENTR Ribosome biogenesis protein bop1 OS=Xenopus tropicalis GN=bop1 PE=2 SV=1 107 747 0.0E+00
sp|A9UZS7|BOP1_MONBE Ribosome biogenesis protein BOP1 homolog OS=Monosiga brevicollis GN=37129 PE=3 SV=1 106 745 0.0E+00
sp|Q14137|BOP1_HUMAN Ribosome biogenesis protein BOP1 OS=Homo sapiens GN=BOP1 PE=1 SV=2 107 747 0.0E+00
sp|Q7K0Y1|BOP1_DROME Ribosome biogenesis protein BOP1 homolog OS=Drosophila melanogaster GN=CG5033 PE=2 SV=1 50 747 0.0E+00
sp|Q4P2E9|ERB1_USTMA Ribosome biogenesis protein ERB1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERB1 PE=3 SV=1 76 746 0.0E+00
sp|A6RRD4|ERB1_BOTFB Ribosome biogenesis protein erb1 OS=Botryotinia fuckeliana (strain B05.10) GN=erb1 PE=3 SV=1 51 747 0.0E+00
sp|Q4WTI3|ERB1_ASPFU Ribosome biogenesis protein erb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erb1 PE=3 SV=1 86 746 0.0E+00
sp|Q2HDW0|ERB1_CHAGB Ribosome biogenesis protein ERB1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ERB1 PE=3 SV=1 78 746 0.0E+00
sp|Q7SEM3|ERB1_NEUCR Ribosome biogenesis protein erb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erb1 PE=3 SV=1 86 746 0.0E+00
sp|A4R0Q1|ERB1_MAGO7 Ribosome biogenesis protein ERB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERB1 PE=3 SV=1 62 746 0.0E+00
sp|B2AY28|ERB1_PODAN Ribosome biogenesis protein ERB1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ERB1 PE=3 SV=1 86 746 0.0E+00
sp|Q0UN56|ERB1_PHANO Ribosome biogenesis protein ERB1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ERB1 PE=3 SV=3 84 746 0.0E+00
sp|B2VR76|ERB1_PYRTR Ribosome biogenesis protein erb1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=erb1 PE=3 SV=1 78 747 0.0E+00
sp|Q2UPK0|ERB1_ASPOR Ribosome biogenesis protein erb1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=erb1 PE=3 SV=1 71 746 0.0E+00
sp|A2QPZ4|ERB1_ASPNC Ribosome biogenesis protein erb1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=erb1 PE=3 SV=1 62 746 0.0E+00
sp|A1CQI9|ERB1_ASPCL Ribosome biogenesis protein erb1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=erb1 PE=3 SV=1 73 746 0.0E+00
sp|Q5BDL3|ERB1_EMENI Ribosome biogenesis protein erb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erb1 PE=3 SV=2 86 746 0.0E+00
sp|B0XQ42|ERB1_ASPFC Ribosome biogenesis protein erb1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=erb1 PE=3 SV=1 86 746 0.0E+00
sp|Q0CCP0|ERB1_ASPTN Ribosome biogenesis protein erb1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=erb1 PE=3 SV=1 52 746 0.0E+00
sp|A6QX61|ERB1_AJECN Ribosome biogenesis protein ERB1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ERB1 PE=3 SV=2 74 747 0.0E+00
sp|A1D3F5|ERB1_NEOFI Ribosome biogenesis protein erb1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=erb1 PE=3 SV=1 86 746 0.0E+00
sp|Q1DRB6|ERB1_COCIM Ribosome biogenesis protein ERB1 OS=Coccidioides immitis (strain RS) GN=ERB1 PE=3 SV=1 58 746 0.0E+00
sp|Q75DC5|ERB1_ASHGO Ribosome biogenesis protein ERB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERB1 PE=3 SV=2 102 747 0.0E+00
sp|Q04660|ERB1_YEAST Ribosome biogenesis protein ERB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERB1 PE=1 SV=1 92 747 0.0E+00
sp|A6ZMA9|ERB1_YEAS7 Ribosome biogenesis protein ERB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ERB1 PE=3 SV=1 92 747 0.0E+00
sp|Q6BRG6|ERB1_DEBHA Ribosome biogenesis protein ERB1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERB1 PE=3 SV=2 41 747 0.0E+00
sp|Q6FLA4|ERB1_CANGA Ribosome biogenesis protein ERB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERB1 PE=3 SV=1 84 747 0.0E+00
sp|B4HN85|BOP1_DROSE Ribosome biogenesis protein BOP1 homolog OS=Drosophila sechellia GN=GM21825 PE=3 SV=1 72 747 9.0E-180
sp|B3NLK7|BOP1_DROER Ribosome biogenesis protein BOP1 homolog OS=Drosophila erecta GN=GG21824 PE=3 SV=1 108 747 7.0E-179
sp|B4P528|BOP1_DROYA Ribosome biogenesis protein BOP1 homolog OS=Drosophila yakuba GN=GE11901 PE=3 SV=1 108 747 1.0E-178
sp|B4LKS9|BOP1_DROVI Ribosome biogenesis protein BOP1 homolog OS=Drosophila virilis GN=GJ22246 PE=3 SV=1 108 747 3.0E-176
sp|B4J9K1|BOP1_DROGR Ribosome biogenesis protein BOP1 homolog OS=Drosophila grimshawi GN=GH22027 PE=3 SV=1 105 747 9.0E-176
sp|B4MYI5|BOP1_DROWI Ribosome biogenesis protein BOP1 homolog OS=Drosophila willistoni GN=GK22227 PE=3 SV=1 108 747 3.0E-175
sp|B4KQU8|BOP1_DROMO Ribosome biogenesis protein BOP1 homolog OS=Drosophila mojavensis GN=GI19116 PE=3 SV=1 105 747 1.0E-174
sp|B3MHX6|BOP1_DROAN Ribosome biogenesis protein BOP1 homolog OS=Drosophila ananassae GN=GF11675 PE=3 SV=1 107 747 2.0E-174
sp|Q28XF0|BOP1_DROPS Ribosome biogenesis protein BOP1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA18610 PE=3 SV=1 108 747 2.0E-174
sp|B4GIU9|BOP1_DROPE Ribosome biogenesis protein BOP1 homolog OS=Drosophila persimilis GN=GL17224 PE=3 SV=1 108 747 3.0E-174
sp|Q7PTC5|BOP1_ANOGA Ribosome biogenesis protein BOP1 homolog OS=Anopheles gambiae GN=AGAP007128 PE=3 SV=4 107 747 2.0E-166
sp|B0WC36|BOP1_CULQU Ribosome biogenesis protein BOP1 homolog OS=Culex quinquefasciatus GN=CPIJ004506 PE=3 SV=1 107 747 1.0E-164
sp|Q17LZ2|BOP1_AEDAE Ribosome biogenesis protein BOP1 homolog OS=Aedes aegypti GN=AAEL001169 PE=3 SV=1 107 747 4.0E-164
sp|Q54TD8|BOP1_DICDI Ribosome biogenesis protein BOP1 homolog OS=Dictyostelium discoideum GN=DDB_G0281839 PE=3 SV=1 118 747 7.0E-156
sp|A8XYW9|BOP1_CAEBR Ribosome biogenesis protein BOP1 homolog OS=Caenorhabditis briggsae GN=CBG20902 PE=3 SV=1 107 747 5.0E-151
sp|Q9U2A9|BOP1_CAEEL Ribosome biogenesis protein BOP1 homolog OS=Caenorhabditis elegans GN=Y48B6A.1 PE=3 SV=1 107 747 9.0E-151
sp|A8ID74|BOP1_CHLRE Ribosome biogenesis protein BOP1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_111274 PE=3 SV=2 104 747 7.0E-148
sp|A8PWB6|BOP1_BRUMA Ribosome biogenesis protein BOP1 homolog OS=Brugia malayi GN=Bm1_36175 PE=3 SV=1 119 747 9.0E-136
sp|A4HUV2|BOP1_LEIIN Ribosome biogenesis protein BOP1 homolog OS=Leishmania infantum GN=LinJ11.0410 PE=3 SV=1 36 747 6.0E-114
sp|Q4QH39|BOP1_LEIMA Ribosome biogenesis protein BOP1 homolog OS=Leishmania major GN=LmjF11.0410 PE=3 SV=1 52 747 3.0E-112
sp|A4H6F7|BOP1_LEIBR Ribosome biogenesis protein BOP1 homolog OS=Leishmania braziliensis GN=LbrM11_V2.0090 PE=3 SV=1 71 747 8.0E-112
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 394 692 5.0E-12
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 399 695 5.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 399 691 2.0E-08
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 399 691 3.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 583 746 4.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 583 746 5.0E-08
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 395 468 6.0E-08
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 396 691 8.0E-08
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 395 468 1.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 382 746 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 395 747 1.0E-07
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 395 468 1.0E-07
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 396 691 2.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 603 746 2.0E-07
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 395 468 4.0E-07
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 395 468 4.0E-07
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 576 746 7.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 399 478 9.0E-07
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 399 692 1.0E-06
sp|Q6CBI8|CIAO1_YARLI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 583 746 1.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 563 746 3.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 563 746 4.0E-06
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 401 470 5.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 398 746 5.0E-06
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 401 472 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0005515 protein binding Yes
GO:0044237 cellular metabolic process No
GO:0034470 ncRNA processing No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016072 rRNA metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|188
MGHKKTTKRRLSLPEESSEDEKIMRSLSKAALTNSDVSLENEDVGEPGGVEDAENDSESGRSSAGHLDQDQDEDA
NGDDAANGPAYRIKFDAHGGQRYEYDEIDPIYDSDDTDVQEPINTIGTIPGSLYDSYPHIGYDINGKKIMRPATG
EALDALLDSIELPKGWTGLVDPQTGKPLTLTQQELELLQRLQLNELPDGGYDPYPEMVPYFTGIEEKMPLSAAPE
PKRRFVPSKHEAKRVAQLVRAIKEGRILPYKPPETPQEQDAEAGQEALYDVWAKQEPEQRHATAIPAPKPAAPGY
DLSYNPPPEYLPSAEERRLWENIDAEDREKDYLPAKFESLRKVPGYSEFVKERFERCLDLYLAPRIRKMRLNVDP
TSLLPKLPSPAELKPFPTICQAIFRGHEGRVRAVAFSPDGEWLASGGDDGTVRVWALNGHQDWAAKLSADEPVNA
VRWRPNRDSFVLAAAAGEDLFFMVPPLCGDAMNRSSRDILSSGFSFVSGESSSAHGVPLKTPAARWSKPSAKLEE
MGVLVKATLRAQIKSLSWHRRGDFLCSTSPSGQRSSVAIHTLSKHLSQIPFRRLSGLAQTAHFHPSRPLFFVATQ
RKIRCYDLQRQELVKVMQPGARWISSFDIHPGGDNVIVGSYDRRLLWHDLDLSSRPYKTMRFHTEAIRAVRFHKT
LPLFADASDDGTLQIFHGKVVNDLMESATIVPVKVLQAHSVVNKLGVMDVDWHPHHPWCASAGADGTCRLWA*
Coding >Ophun1|188
ATGGGTCACAAAAAGACTACCAAGCGGAGATTGTCTCTCCCCGAGGAGTCGTCCGAGGATGAGAAGATCATGAGA
TCACTGTCGAAAGCCGCTCTCACAAATAGCGACGTCAGCCTTGAAAATGAAGATGTTGGCGAACCCGGAGGCGTA
GAAGATGCCGAAAATGACAGTGAGTCAGGAAGAAGCAGCGCAGGTCATCTGGACCAGGACCAAGATGAGGATGCG
AACGGCGACGACGCCGCGAATGGGCCGGCATATCGCATCAAGTTTGACGCCCATGGAGGCCAGCGCTACGAGTAC
GACGAGATCGATCCTATCTATGATAGCGACGACACTGATGTGCAAGAACCAATCAACACCATCGGGACTATCCCG
GGTTCGCTCTACGACTCCTATCCTCACATAGGATACGACATCAATGGAAAGAAGATTATGCGCCCCGCCACCGGC
GAAGCTCTCGATGCGCTTCTCGACAGCATAGAGCTTCCCAAGGGCTGGACCGGCCTCGTGGATCCTCAGACGGGC
AAGCCGCTCACGCTGACGCAACAGGAGTTGGAATTGCTCCAGCGGTTACAGCTCAACGAGTTGCCCGACGGCGGT
TACGACCCTTATCCTGAAATGGTGCCTTATTTTACTGGCATCGAAGAGAAGATGCCTTTGAGTGCGGCCCCGGAG
CCAAAACGTCGGTTCGTCCCGTCCAAGCACGAGGCCAAGCGCGTAGCACAACTTGTACGGGCCATCAAAGAGGGA
CGCATTCTGCCTTACAAACCCCCGGAAACCCCCCAAGAACAGGACGCTGAAGCAGGGCAAGAAGCGCTCTACGAC
GTATGGGCCAAGCAAGAGCCGGAGCAGCGACATGCGACCGCGATTCCGGCGCCCAAACCGGCGGCGCCCGGCTAC
GATCTCAGCTACAATCCACCCCCAGAATATCTTCCCAGTGCCGAGGAGAGAAGGCTTTGGGAGAACATTGATGCC
GAAGATCGCGAGAAAGACTACCTTCCAGCCAAGTTCGAGTCTTTGCGCAAGGTGCCTGGCTATTCCGAATTCGTC
AAAGAGAGGTTCGAGAGGTGTTTGGACCTCTATCTCGCCCCGAGAATCCGCAAAATGCGCCTCAACGTCGATCCC
ACCTCACTGCTCCCTAAGCTCCCCAGCCCAGCAGAACTTAAGCCTTTCCCTACAATCTGTCAGGCGATATTCAGG
GGGCACGAGGGGCGAGTTCGTGCTGTGGCCTTCAGCCCAGACGGAGAGTGGCTCGCGTCCGGTGGTGATGACGGC
ACTGTCCGCGTGTGGGCACTCAATGGCCACCAGGACTGGGCTGCCAAGCTGTCGGCTGATGAGCCGGTCAATGCC
GTCAGGTGGCGACCGAATCGTGATAGCTTTGTGCTTGCTGCTGCGGCCGGAGAGGATCTCTTCTTCATGGTTCCG
CCTCTATGTGGCGATGCGATGAACAGGTCAAGTCGCGATATCTTGAGTTCCGGTTTCAGCTTCGTTTCTGGAGAG
TCATCCTCCGCTCACGGAGTTCCTCTCAAAACGCCAGCAGCGCGCTGGTCCAAACCGTCAGCGAAGCTCGAGGAA
ATGGGTGTCCTGGTCAAGGCCACGCTGAGAGCGCAAATCAAGTCGCTCAGCTGGCATCGACGCGGCGACTTTCTC
TGTTCGACATCACCGAGCGGGCAACGGAGTTCAGTCGCTATCCACACACTTTCCAAGCACCTCAGCCAGATCCCC
TTCCGACGCCTTTCCGGGCTTGCTCAAACGGCACACTTCCATCCCTCGAGGCCGCTCTTCTTCGTCGCGACGCAA
CGCAAGATTCGTTGCTATGACCTGCAGAGACAAGAGCTCGTCAAGGTGATGCAACCGGGTGCTCGCTGGATCTCG
TCTTTTGACATTCATCCGGGGGGCGATAACGTCATTGTCGGCTCATACGATCGTCGGTTGCTATGGCACGATTTG
GACTTGTCCAGTCGGCCGTACAAGACGATGAGATTCCATACCGAGGCAATCCGAGCCGTCAGGTTTCACAAAACT
CTTCCGCTCTTCGCAGATGCCAGCGACGACGGAACGCTGCAAATATTCCACGGCAAGGTTGTCAATGACTTGATG
GAGAGCGCCACAATTGTGCCCGTTAAGGTGCTACAGGCACATTCCGTCGTCAACAAGCTGGGAGTCATGGACGTG
GACTGGCACCCTCATCATCCTTGGTGCGCCAGCGCGGGAGCGGACGGAACATGTCGACTTTGGGCGTGA
Transcript >Ophun1|188
ATGGGTCACAAAAAGACTACCAAGCGGAGATTGTCTCTCCCCGAGGAGTCGTCCGAGGATGAGAAGATCATGAGA
TCACTGTCGAAAGCCGCTCTCACAAATAGCGACGTCAGCCTTGAAAATGAAGATGTTGGCGAACCCGGAGGCGTA
GAAGATGCCGAAAATGACAGTGAGTCAGGAAGAAGCAGCGCAGGTCATCTGGACCAGGACCAAGATGAGGATGCG
AACGGCGACGACGCCGCGAATGGGCCGGCATATCGCATCAAGTTTGACGCCCATGGAGGCCAGCGCTACGAGTAC
GACGAGATCGATCCTATCTATGATAGCGACGACACTGATGTGCAAGAACCAATCAACACCATCGGGACTATCCCG
GGTTCGCTCTACGACTCCTATCCTCACATAGGATACGACATCAATGGAAAGAAGATTATGCGCCCCGCCACCGGC
GAAGCTCTCGATGCGCTTCTCGACAGCATAGAGCTTCCCAAGGGCTGGACCGGCCTCGTGGATCCTCAGACGGGC
AAGCCGCTCACGCTGACGCAACAGGAGTTGGAATTGCTCCAGCGGTTACAGCTCAACGAGTTGCCCGACGGCGGT
TACGACCCTTATCCTGAAATGGTGCCTTATTTTACTGGCATCGAAGAGAAGATGCCTTTGAGTGCGGCCCCGGAG
CCAAAACGTCGGTTCGTCCCGTCCAAGCACGAGGCCAAGCGCGTAGCACAACTTGTACGGGCCATCAAAGAGGGA
CGCATTCTGCCTTACAAACCCCCGGAAACCCCCCAAGAACAGGACGCTGAAGCAGGGCAAGAAGCGCTCTACGAC
GTATGGGCCAAGCAAGAGCCGGAGCAGCGACATGCGACCGCGATTCCGGCGCCCAAACCGGCGGCGCCCGGCTAC
GATCTCAGCTACAATCCACCCCCAGAATATCTTCCCAGTGCCGAGGAGAGAAGGCTTTGGGAGAACATTGATGCC
GAAGATCGCGAGAAAGACTACCTTCCAGCCAAGTTCGAGTCTTTGCGCAAGGTGCCTGGCTATTCCGAATTCGTC
AAAGAGAGGTTCGAGAGGTGTTTGGACCTCTATCTCGCCCCGAGAATCCGCAAAATGCGCCTCAACGTCGATCCC
ACCTCACTGCTCCCTAAGCTCCCCAGCCCAGCAGAACTTAAGCCTTTCCCTACAATCTGTCAGGCGATATTCAGG
GGGCACGAGGGGCGAGTTCGTGCTGTGGCCTTCAGCCCAGACGGAGAGTGGCTCGCGTCCGGTGGTGATGACGGC
ACTGTCCGCGTGTGGGCACTCAATGGCCACCAGGACTGGGCTGCCAAGCTGTCGGCTGATGAGCCGGTCAATGCC
GTCAGGTGGCGACCGAATCGTGATAGCTTTGTGCTTGCTGCTGCGGCCGGAGAGGATCTCTTCTTCATGGTTCCG
CCTCTATGTGGCGATGCGATGAACAGGTCAAGTCGCGATATCTTGAGTTCCGGTTTCAGCTTCGTTTCTGGAGAG
TCATCCTCCGCTCACGGAGTTCCTCTCAAAACGCCAGCAGCGCGCTGGTCCAAACCGTCAGCGAAGCTCGAGGAA
ATGGGTGTCCTGGTCAAGGCCACGCTGAGAGCGCAAATCAAGTCGCTCAGCTGGCATCGACGCGGCGACTTTCTC
TGTTCGACATCACCGAGCGGGCAACGGAGTTCAGTCGCTATCCACACACTTTCCAAGCACCTCAGCCAGATCCCC
TTCCGACGCCTTTCCGGGCTTGCTCAAACGGCACACTTCCATCCCTCGAGGCCGCTCTTCTTCGTCGCGACGCAA
CGCAAGATTCGTTGCTATGACCTGCAGAGACAAGAGCTCGTCAAGGTGATGCAACCGGGTGCTCGCTGGATCTCG
TCTTTTGACATTCATCCGGGGGGCGATAACGTCATTGTCGGCTCATACGATCGTCGGTTGCTATGGCACGATTTG
GACTTGTCCAGTCGGCCGTACAAGACGATGAGATTCCATACCGAGGCAATCCGAGCCGTCAGGTTTCACAAAACT
CTTCCGCTCTTCGCAGATGCCAGCGACGACGGAACGCTGCAAATATTCCACGGCAAGGTTGTCAATGACTTGATG
GAGAGCGCCACAATTGTGCCCGTTAAGGTGCTACAGGCACATTCCGTCGTCAACAAGCTGGGAGTCATGGACGTG
GACTGGCACCCTCATCATCCTTGGTGCGCCAGCGCGGGAGCGGACGGAACATGTCGACTTTGGGCGTGA
Gene >Ophun1|188
ATGGGTCACAAAAAGACTACCAAGCGGAGATTGTCTCTCCCCGAGGAGTCGTCCGAGGATGAGAAGATCATGAGA
TCACTGTCGAAAGCCGCTCTCACAAATAGCGACGTCAGCCTTGAAAATGAAGATGTTGGCGAACCCGGAGGCGTA
GAAGATGCCGAAAATGACAGTGAGTCAGGAAGAAGCAGCGCAGGTCATCTGGACCAGGACCAAGATGAGGATGCG
AACGGCGACGACGCCGCGAATGGGCCGGCATATCGCATCAAGTTTGACGCCCATGGAGGCCAGCGCTACGAGTAC
GACGAGATCGATCCTATCTATGATAGCGACGACACTGATGTGCAAGAACCAATCAACACCATCGGGACTATCCCG
GGTTCGCTCTACGACTCCTATCCTCACATAGGATACGACATCAATGGAAAGAAGATTATGCGCCCCGCCACCGGC
GAAGCTCTCGATGCGCTTCTCGACAGCATAGAGCTTCCCAAGGGCTGGACCGGCCTCGTGGATCCTCAGACGGGC
AAGCCGCTCACGCTGACGCAACAGGAGTTGGAATTGCTCCAGCGGTTACAGCTCAACGAGTTGCCCGACGGCGGT
TACGACCCTTATCCTGTAGGTGATCTAGCGATTGGTGATGGTGCTGCGAGCTAACCGTAACTCAGGAAATGGTGC
CTTATTTTACTGGCATCGAAGAGAAGATGCCTTTGAGTGCGGCCCCGGAGCCAAAACGTCGGTTCGTCCCGTCCA
AGCACGAGGCCAAGCGCGTAGCACAACTTGTACGGGCCATCAAAGAGGGACGCATTCTGCCTTACAAACCCCCGG
AAACCCCCCAAGAACAGGACGCTGAAGCAGGGCAAGAAGCGCTCTACGACGTATGGGCCAAGCAAGAGCCGGAGC
AGCGACATGCGACCGCGATTCCGGCGCCCAAACCGGCGGCGCCCGGCTACGATCTCAGCTACAATCCACCCCCAG
AATATCTTCCCAGTGCCGAGGAGAGAAGGCTTTGGGAGAACATTGATGCCGAAGATCGCGAGAAAGACTACCTTC
CAGCCAAGTTCGAGTCTTTGCGCAAGGTGCCTGGCTATTCCGAATTCGTCAAAGAGAGGTTCGAGAGGTGTTTGG
ACCTCTATCTCGCCCCGAGAATCCGCAAAATGCGCCTCAACGTCGATCCCACCTCACTGCTCCCTAAGCTCCCCA
GCCCAGCAGAACTTAAGCCTTTCCCTACAATCTGTCAGGCGATATTCAGGGGGCACGAGGGGCGAGTTCGTGCTG
TGGCCTTCAGCCCAGACGGAGAGTGGCTCGCGTCCGGTGGTGATGACGGCACTGTCCGCGTGTGGGCACTCAATG
GCCACCAGGACTGGGCTGCCAAGCTGTCGGCTGATGAGCCGGTCAATGCCGTCAGGTGGCGACCGAATCGTGATA
GCTTTGTGCTTGCTGCTGCGGCCGGAGAGGATCTCTTCTTCATGGTTCCGCCTCTATGTGGCGATGCGATGAACA
GGTCAAGTCGCGATATCTTGAGTTCCGGTTTCAGCTTCGTTTCTGGAGAGTCATCCTCCGCTCACGGAGTTCCTC
TCAAAACGCCAGCAGCGCGCTGGTCCAAACCGTCAGCGAAGCTCGAGGAAATGGGTGTCCTGGTCAAGGCCACGC
TGAGAGCGCAAATCAAGTCGCTCAGCTGGCATCGACGCGGCGACTTTCTCTGTTCGACATCACCGAGCGGGCAAC
GGAGTTCAGTCGCTATCCACACACTTTCCAAGCACCTCAGCCAGATCCCCTTCCGACGCCTTTCCGGGCTTGCTC
AAACGGCACACTTCCATCCCTCGAGGCCGCTCTTCTTCGTCGCGACGCAACGCAAGATTCGTTGCTATGACCTGC
AGAGACAAGAGCTCGTCAAGGTGATGCAACCGGGTGCTCGCTGGATCTCGTCTTTTGACATTCATCCGGGGGGCG
ATAACGTCATTGTCGGCTCATACGATCGTCGGTTGCTATGGCACGATTTGGACTTGTCCAGTCGGCCGTACAAGA
CGATGAGATTCCATACCGAGGCAATCCGAGCCGTCAGGTTTCACAAAACTCTTCCGCTCTTCGCAGATGCCAGCG
ACGACGGAACGCTGCAAATATTCCACGGCAAGGTTGTCAATGACTTGATGGAGAGCGCCACAATTGTGCCCGTTA
AGGTGCTACAGGCACATTCCGTCGTCAACAAGCTGGGAGTCATGGACGTGGACTGGCACCCTCATCATCCTTGGT
GCGCCAGCGCGGGAGCGGACGGAACATGTCGACTTTGGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail