Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1879
Gene name
LocationContig_184:9404..10710
Strand+
Gene length (bp)1306
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13012 MitMem_reg Maintenance of mitochondrial structure and function 1.0E-09 264 374
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 8.1E-08 18 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C8|CSN6_NEUCR COP9 signalosome complex subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-6 PE=1 SV=1 1 406 8.0E-87
sp|Q5BB47|CSN6_EMENI COP9 signalosome complex subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnF PE=1 SV=2 12 385 3.0E-72
sp|A6QQ21|CSN6_BOVIN COP9 signalosome complex subunit 6 OS=Bos taurus GN=COPS6 PE=2 SV=1 2 394 1.0E-25
sp|A7TX81|CSN6_PIG COP9 signalosome complex subunit 6 OS=Sus scrofa GN=COPS6 PE=2 SV=1 2 394 3.0E-25
sp|Q5REY0|CSN6_PONAB COP9 signalosome complex subunit 6 OS=Pongo abelii GN=COPS6 PE=2 SV=1 2 394 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C8|CSN6_NEUCR COP9 signalosome complex subunit 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-6 PE=1 SV=1 1 406 8.0E-87
sp|Q5BB47|CSN6_EMENI COP9 signalosome complex subunit 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnF PE=1 SV=2 12 385 3.0E-72
sp|A6QQ21|CSN6_BOVIN COP9 signalosome complex subunit 6 OS=Bos taurus GN=COPS6 PE=2 SV=1 2 394 1.0E-25
sp|A7TX81|CSN6_PIG COP9 signalosome complex subunit 6 OS=Sus scrofa GN=COPS6 PE=2 SV=1 2 394 3.0E-25
sp|Q5REY0|CSN6_PONAB COP9 signalosome complex subunit 6 OS=Pongo abelii GN=COPS6 PE=2 SV=1 2 394 4.0E-25
sp|Q7L5N1|CSN6_HUMAN COP9 signalosome complex subunit 6 OS=Homo sapiens GN=COPS6 PE=1 SV=1 2 394 1.0E-24
sp|O88545|CSN6_MOUSE COP9 signalosome complex subunit 6 OS=Mus musculus GN=Cops6 PE=1 SV=1 9 394 2.0E-24
sp|Q07G98|CSN6_XENTR COP9 signalosome complex subunit 6 OS=Xenopus tropicalis GN=cops6 PE=2 SV=1 9 394 1.0E-21
sp|Q6NUC2|CSN6_XENLA COP9 signalosome complex subunit 6 OS=Xenopus laevis GN=cops6 PE=2 SV=1 9 394 4.0E-21
sp|Q54C92|CSN6_DICDI COP9 signalosome complex subunit 6 OS=Dictyostelium discoideum GN=csn6 PE=1 SV=1 9 394 8.0E-17
sp|Q9VCY3|CSN6_DROME COP9 signalosome complex subunit 6 OS=Drosophila melanogaster GN=CSN6 PE=1 SV=1 4 394 7.0E-16
sp|Q8W1P0|CSN6B_ARATH COP9 signalosome complex subunit 6b OS=Arabidopsis thaliana GN=CSN6B PE=1 SV=2 10 378 1.0E-10
sp|Q8W206|CSN6A_ARATH COP9 signalosome complex subunit 6a OS=Arabidopsis thaliana GN=CSN6A PE=1 SV=2 10 378 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0005515 protein binding Yes
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0101005 deubiquitinase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0005488 binding No
GO:0008237 metallopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1879
MAAPAPNPLMSSQKSSQLQTVLHPLVLLAISDYVTRHSLRCQEGPIVGALLGQQNGREITIEHVFDCHTRAASGV
EGGYLLDVDRFAARLEQMMTVHKERQLDLVGWYTLLPTSGPTPSVVPIHKQILQQWNESALLLGFHPEEALKHSV
GGKLPLTIYESNYEVDDSAGGGAEGDEDKRMDDGETAALKLKFREVPYSVETDDTEMISMNYIAGAGGNASTVSG
TASTKEDRPARSVESNGKGKRRLVESEADDTAKSLPDADEVLTHDEEKTLATLTAKANAIKMLHARLRLIATYLE
RLPPTPPPTTAEDSMDTDSTTPSLPILRQIQALVTRLDLVIPSDSEAFAAESLQQANDVQLMDLLNSVMQAVGKT
REVGRQSAVVENGKAVGRRGPAGLSADAMFSLGSAGDIFL*
Coding >Ophun1|1879
ATGGCAGCGCCCGCCCCGAACCCGCTCATGTCCAGCCAGAAGAGCTCTCAGCTCCAGACGGTCCTCCACCCGCTC
GTCCTGCTGGCCATATCCGACTACGTCACGCGGCACAGCTTGCGATGCCAGGAGGGGCCCATCGTCGGCGCTCTC
CTCGGGCAGCAAAACGGACGCGAGATCACGATAGAGCATGTCTTTGACTGTCATACGCGTGCTGCGTCTGGGGTT
GAGGGCGGGTACCTCTTGGACGTTGATCGGTTTGCGGCGAGGTTGGAACAGATGATGACGGTGCACAAGGAGAGG
CAGCTTGATCTGGTCGGCTGGTATACGCTTCTTCCGACTTCGGGGCCGACACCATCGGTCGTGCCCATCCACAAA
CAGATTCTCCAGCAGTGGAACGAGTCAGCCTTGCTCCTAGGTTTCCATCCGGAAGAGGCGCTGAAGCACTCAGTC
GGCGGCAAACTCCCCCTGACCATCTACGAGAGCAACTACGAAGTCGACGATAGCGCAGGCGGCGGCGCTGAAGGC
GATGAGGATAAACGCATGGACGACGGCGAGACAGCCGCCCTCAAGCTCAAGTTCCGCGAGGTGCCGTACTCGGTT
GAGACGGATGACACGGAGATGATAAGCATGAATTACATCGCCGGCGCTGGGGGTAACGCCTCCACCGTCTCGGGA
ACGGCCTCGACAAAGGAAGATCGTCCTGCCCGTTCGGTAGAGTCCAACGGCAAGGGGAAGCGCAGACTGGTGGAA
AGCGAAGCAGACGACACAGCCAAATCCCTCCCCGACGCAGACGAAGTCCTAACCCACGACGAGGAAAAAACACTC
GCCACCCTGACCGCCAAAGCAAACGCCATCAAAATGCTCCACGCCCGCCTCCGCCTCATAGCAACATACCTCGAA
CGCCTACCCCCCACCCCCCCCCCAACAACAGCAGAAGACTCCATGGACACCGACTCAACCACCCCCTCCCTCCCC
ATCCTCCGCCAGATCCAAGCCCTCGTCACCCGCCTCGACCTCGTCATCCCCTCCGACAGCGAGGCCTTCGCCGCC
GAATCCCTGCAGCAGGCCAACGACGTGCAGCTCATGGACCTGCTCAACTCGGTCATGCAGGCCGTCGGCAAGACC
CGTGAAGTGGGCAGGCAATCGGCCGTCGTGGAGAATGGCAAGGCCGTTGGGAGGAGGGGGCCGGCTGGGTTGTCG
GCGGATGCCATGTTTAGCTTGGGCAGCGCTGGGGATATCTTTCTGTGA
Transcript >Ophun1|1879
ATGGCAGCGCCCGCCCCGAACCCGCTCATGTCCAGCCAGAAGAGCTCTCAGCTCCAGACGGTCCTCCACCCGCTC
GTCCTGCTGGCCATATCCGACTACGTCACGCGGCACAGCTTGCGATGCCAGGAGGGGCCCATCGTCGGCGCTCTC
CTCGGGCAGCAAAACGGACGCGAGATCACGATAGAGCATGTCTTTGACTGTCATACGCGTGCTGCGTCTGGGGTT
GAGGGCGGGTACCTCTTGGACGTTGATCGGTTTGCGGCGAGGTTGGAACAGATGATGACGGTGCACAAGGAGAGG
CAGCTTGATCTGGTCGGCTGGTATACGCTTCTTCCGACTTCGGGGCCGACACCATCGGTCGTGCCCATCCACAAA
CAGATTCTCCAGCAGTGGAACGAGTCAGCCTTGCTCCTAGGTTTCCATCCGGAAGAGGCGCTGAAGCACTCAGTC
GGCGGCAAACTCCCCCTGACCATCTACGAGAGCAACTACGAAGTCGACGATAGCGCAGGCGGCGGCGCTGAAGGC
GATGAGGATAAACGCATGGACGACGGCGAGACAGCCGCCCTCAAGCTCAAGTTCCGCGAGGTGCCGTACTCGGTT
GAGACGGATGACACGGAGATGATAAGCATGAATTACATCGCCGGCGCTGGGGGTAACGCCTCCACCGTCTCGGGA
ACGGCCTCGACAAAGGAAGATCGTCCTGCCCGTTCGGTAGAGTCCAACGGCAAGGGGAAGCGCAGACTGGTGGAA
AGCGAAGCAGACGACACAGCCAAATCCCTCCCCGACGCAGACGAAGTCCTAACCCACGACGAGGAAAAAACACTC
GCCACCCTGACCGCCAAAGCAAACGCCATCAAAATGCTCCACGCCCGCCTCCGCCTCATAGCAACATACCTCGAA
CGCCTACCCCCCACCCCCCCCCCAACAACAGCAGAAGACTCCATGGACACCGACTCAACCACCCCCTCCCTCCCC
ATCCTCCGCCAGATCCAAGCCCTCGTCACCCGCCTCGACCTCGTCATCCCCTCCGACAGCGAGGCCTTCGCCGCC
GAATCCCTGCAGCAGGCCAACGACGTGCAGCTCATGGACCTGCTCAACTCGGTCATGCAGGCCGTCGGCAAGACC
CGTGAAGTGGGCAGGCAATCGGCCGTCGTGGAGAATGGCAAGGCCGTTGGGAGGAGGGGGCCGGCTGGGTTGTCG
GCGGATGCCATGTTTAGCTTGGGCAGCGCTGGGGATATCTTTCTGTGA
Gene >Ophun1|1879
ATGGCAGCGCCCGCCCCGAACCCGCTCATGTCCAGCCAGAAGAGCTCTCAGCTCCAGACGGTCCTCCACCCGCTC
GTCCTGCTGGCCATATCCGACTACGTCACGCGGCACAGCTTGCGATGCCAGGAGGGGCCCATCGTCGGCGCTCTC
CTCGGGCAGCAAAACGGACGCGAGATCACGATAGAGCATGTCTTTGACTGTCATACGCGTGCTGCGTCTGGGGTT
GAGGGCGGGTACCTCTTGGACGTTGATCGGTTTGCGGCGAGGTTGGAACAGAGTTAGTGCGGCGTCTTGTACTCT
TGGGTGTGGTTGTGATGTTGATCTTGAGTTTGCAGTGATGACGGTGCACAAGGAGAGGCAGCTTGATCTGGTCGG
CTGGTATACGCTTCTTCCGACTTCGGGGCCGACACCATCGGTCGTGCCCATCCACAAACAGATTCTCCAGCAGTG
GAACGAGTCAGCCTTGCTCCTAGGTTTCCATCCGGAAGAGGCGCTGAAGCACTCAGTCGGCGGCAAACTCCCCCT
GACCATCTACGAGAGCAACTACGAAGTCGACGATAGCGCAGGCGGCGGCGCTGAAGGCGATGAGGATAAACGCAT
GGACGACGGCGAGACAGCCGCCCTCAAGCTCAAGTTCCGCGAGGTGCCGTACTCGGTTGAGACGGATGACACGGA
GATGATAAGCATGAATTACATCGCCGGCGCTGGGGGTAACGCCTCCACCGTCTCGGGAACGGCCTCGACAAAGGA
AGATCGTCCTGCCCGTTCGGTAGAGTCCAACGGCAAGGGGAAGCGCAGACTGGTGGAAAGCGAAGCAGACGACAC
AGCCAAATCCCTCCCCGACGCAGACGAAGTCCTAACCCACGACGAGGAAAAAACACTCGCCACCCTGACCGCCAA
AGCAAACGCCATCAAAATGCTCCACGCCCGCCTCCGCCTCATAGCAACATACCTCGAACGCCTACCCCCCACCCC
CCCCCCAACAACAGCAGAAGACTCCATGGACACCGACTCAACCACCCCCTCCCTCCCCATCCTCCGCCAGATCCA
AGCCCTCGTCACCCGCCTCGACCTCGTCATCCCCTCCGACAGCGAGGCCTTCGCCGCCGAATCCCTGCAGCAGGC
CAACGACGTGCAGCTCATGGACCTGCTCAACTCGGTCATGCAGGCCGTCGGCAAGACCCGTGAAGTGGGCAGGCA
ATCGGCCGTCGTGGAGAATGGCAAGGCCGTTGGGAGGAGGGGGCCGGCTGGGTTGTCGGCGGATGCCATGTTTAG
CTTGGGCAGCGCTGGGGATATCTTTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail