Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1875
Gene name
LocationContig_1831:835..1195
Strand-
Gene length (bp)360
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 6.6E-10 1 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34240|ZRT3_YEAST Zinc-regulated transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT3 PE=1 SV=2 1 85 1.0E-11
sp|Q8DRY7|ZUPT_STRMU Zinc transporter ZupT OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=zupT PE=3 SV=1 6 116 3.0E-11
sp|B2UL32|ZUPT_AKKM8 Zinc transporter ZupT OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=zupT PE=3 SV=1 1 83 5.0E-11
sp|Q8ENQ1|ZUPT_OCEIH Zinc transporter ZupT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=zupT PE=3 SV=1 1 117 2.0E-09
sp|C3PFG5|ZUPT_CORA7 Zinc transporter ZupT OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=zupT PE=3 SV=1 1 116 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34240|ZRT3_YEAST Zinc-regulated transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT3 PE=1 SV=2 1 85 1.0E-11
sp|Q8DRY7|ZUPT_STRMU Zinc transporter ZupT OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=zupT PE=3 SV=1 6 116 3.0E-11
sp|B2UL32|ZUPT_AKKM8 Zinc transporter ZupT OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=zupT PE=3 SV=1 1 83 5.0E-11
sp|Q8ENQ1|ZUPT_OCEIH Zinc transporter ZupT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=zupT PE=3 SV=1 1 117 2.0E-09
sp|C3PFG5|ZUPT_CORA7 Zinc transporter ZupT OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=zupT PE=3 SV=1 1 116 2.0E-09
sp|Q8FTK0|ZUPT_COREF Zinc transporter ZupT OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=zupT PE=3 SV=1 1 116 8.0E-09
sp|B7NJQ3|ZUPT_ECO7I Zinc transporter ZupT OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=zupT PE=3 SV=1 1 116 1.0E-08
sp|Q8XMG8|ZUPT_CLOPE Zinc transporter ZupT OS=Clostridium perfringens (strain 13 / Type A) GN=zupT PE=3 SV=1 6 116 1.0E-08
sp|B3QP89|ZUPT_CHLP8 Zinc transporter ZupT OS=Chlorobaculum parvum (strain NCIB 8327) GN=zupT PE=3 SV=1 1 116 2.0E-08
sp|O94402|ZIP2_SCHPO Probable zinc transporter zip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zip2 PE=3 SV=2 1 96 2.0E-08
sp|B3ECE6|ZUPT_CHLL2 Zinc transporter ZupT OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=zupT PE=3 SV=1 5 112 3.0E-08
sp|Q8NQK0|ZUPT_CORGL Zinc transporter ZupT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=zupT PE=3 SV=1 1 116 4.0E-08
sp|Q54LY6|ZNTB_DICDI Protein zntB OS=Dictyostelium discoideum GN=zntB PE=2 SV=1 1 112 4.0E-08
sp|A1KRK6|ZUPT_NEIMF Zinc transporter ZupT OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=zupT PE=3 SV=1 1 116 5.0E-08
sp|Q9JX23|ZUPT_NEIMA Zinc transporter ZupT OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=zupT PE=3 SV=1 1 116 5.0E-08
sp|Q3AU90|ZUPT_CHLCH Zinc transporter ZupT OS=Chlorobium chlorochromatii (strain CaD3) GN=zupT PE=3 SV=1 1 116 7.0E-08
sp|Q9K1H6|ZUPT_NEIMB Zinc transporter ZupT OS=Neisseria meningitidis serogroup B (strain MC58) GN=zupT PE=3 SV=1 1 116 1.0E-07
sp|A4SE48|ZUPT_CHLPM Zinc transporter ZupT OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=zupT PE=3 SV=1 5 117 2.0E-07
sp|Q9PIN2|ZUPT_CAMJE Zinc transporter ZupT OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=zupT PE=3 SV=1 6 112 4.0E-07
sp|Q3B4G1|ZUPT_CHLL7 Zinc transporter ZupT OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=zupT PE=3 SV=1 5 112 4.0E-07
sp|B1HYT6|ZUPT_LYSSC Zinc transporter ZupT OS=Lysinibacillus sphaericus (strain C3-41) GN=zupT PE=3 SV=1 6 115 9.0E-07
sp|Q8P8Z6|ZUPT_XANCP Zinc transporter ZupT OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=zupT PE=3 SV=1 2 83 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 64 86 22
3 96 118 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1875
MALFVHNITEGFALALPLYMALGSRWRAMLWSAILGGLSQPIGAGAAALWFHLASRTHLTPNAVAYACLFAATAG
IMVSVALQLFVESLSLNHNRNLCIFFGFLGMVLMGFSSALFAAH*
Coding >Ophun1|1875
ATGGCCCTCTTCGTCCACAACATCACAGAGGGTTTCGCCCTCGCCCTCCCCCTCTACATGGCCCTCGGCTCCCGC
TGGCGCGCAATGCTCTGGTCCGCCATCCTCGGCGGCCTCTCCCAGCCCATTGGCGCCGGCGCCGCTGCCCTCTGG
TTCCATCTCGCCAGCAGGACGCACCTCACGCCCAATGCCGTCGCCTACGCTTGTCTTTTTGCCGCCACGGCGGGC
ATCATGGTTAGCGTGGCGTTGCAGCTCTTTGTCGAGAGTCTGAGCCTCAACCACAACCGCAACTTGTGCATCTTT
TTCGGTTTTCTGGGTATGGTGCTTATGGGCTTTAGCAGCGCTCTTTTCGCCGCGCACTAG
Transcript >Ophun1|1875
ATGGCCCTCTTCGTCCACAACATCACAGAGGGTTTCGCCCTCGCCCTCCCCCTCTACATGGCCCTCGGCTCCCGC
TGGCGCGCAATGCTCTGGTCCGCCATCCTCGGCGGCCTCTCCCAGCCCATTGGCGCCGGCGCCGCTGCCCTCTGG
TTCCATCTCGCCAGCAGGACGCACCTCACGCCCAATGCCGTCGCCTACGCTTGTCTTTTTGCCGCCACGGCGGGC
ATCATGGTTAGCGTGGCGTTGCAGCTCTTTGTCGAGAGTCTGAGCCTCAACCACAACCGCAACTTGTGCATCTTT
TTCGGTTTTCTGGGTATGGTGCTTATGGGCTTTAGCAGCGCTCTTTTCGCCGCGCACTAG
Gene >Ophun1|1875
ATGGCCCTCTTCGTCCACAACATCACAGAGGGTTTCGCCCTCGCCCTCCCCCTCTACATGGCCCTCGGCTCCCGC
TGGCGCGCAATGCTCTGGTCCGCCATCCTCGGCGGCCTCTCCCAGCCCATTGGCGCCGGCGCCGCTGCCCTCTGG
TTCCATCTCGCCAGCAGGACGCACCTCACGCCCAATGCCGTCGCCTACGCTTGTCTTTTTGCCGCCACGGCGGGC
ATCATGGTTAGCGTGGCGTTGCAGCTCTTTGTCGAGAGTCTGAGCCTCAACCACAACCGCAACTTGTGCATCTTT
TTCGGTTTTCTGGGTATGGTGCTTATGGGCTTTAGCAGCGCTCTTTTCGCCGCGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail