Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1873
Gene name
LocationContig_183:14921..28451
Strand+
Gene length (bp)13530
Transcript length (bp)13362
Coding sequence length (bp)13362
Protein length (aa) 4454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.0E-34 233 477
PF00501 AMP-binding AMP-binding enzyme 1.3E-12 494 575
PF00501 AMP-binding AMP-binding enzyme 2.9E-68 1259 1650
PF00501 AMP-binding AMP-binding enzyme 2.7E-42 2327 2730
PF00501 AMP-binding AMP-binding enzyme 1.0E-37 3407 3788
PF00668 Condensation Condensation domain 1.9E-40 817 1220
PF00668 Condensation Condensation domain 2.1E-32 1898 2297
PF00668 Condensation Condensation domain 9.4E-34 2971 3385
PF00668 Condensation Condensation domain 1.1E-27 4059 4364
PF00550 PP-binding Phosphopantetheine attachment site 3.5E-08 714 775
PF00550 PP-binding Phosphopantetheine attachment site 6.6E-15 1790 1853
PF00550 PP-binding Phosphopantetheine attachment site 7.4E-11 2867 2926
PF00550 PP-binding Phosphopantetheine attachment site 3.0E-12 3930 3993

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 776 4207 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 20 2948 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1888 4308 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 147 3277 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 749 4308 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 776 4207 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 20 2948 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1888 4308 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 147 3277 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 749 4308 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1242 3308 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2319 4427 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 225 2186 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1242 3308 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2319 4427 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 225 2188 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1242 3065 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 225 2188 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2319 4449 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 159 2062 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1230 3131 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2320 4108 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 21 2048 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 962 2948 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2254 3989 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 486 4363 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 130 4377 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 815 4365 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 496 3993 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 815 4381 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 815 4381 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 223 3993 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 813 3999 5.0E-180
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1234 3030 8.0E-180
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 225 2044 2.0E-179
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 58 3144 2.0E-178
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 769 2216 3.0E-177
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1196 2342 3.0E-177
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 250 3313 2.0E-174
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 494 3967 5.0E-174
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 494 3967 3.0E-173
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 239 3144 6.0E-171
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 813 4098 2.0E-168
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2969 4431 2.0E-167
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2272 3397 1.0E-158
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 853 4195 3.0E-158
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 811 4000 9.0E-158
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 496 3270 5.0E-155
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 209 3158 5.0E-154
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 222 2296 5.0E-154
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2322 4244 2.0E-153
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 147 3029 2.0E-152
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1227 4365 5.0E-148
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 814 3113 6.0E-148
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 665 3109 1.0E-147
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 499 2932 4.0E-146
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2321 4366 6.0E-143
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 974 3371 2.0E-141
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 811 3026 4.0E-141
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 496 2971 2.0E-140
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1195 4205 4.0E-140
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1268 4344 4.0E-138
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1865 3289 5.0E-138
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 496 2971 2.0E-137
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1270 4184 2.0E-137
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 177 2241 2.0E-135
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 817 2929 5.0E-135
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 778 3213 1.0E-134
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 816 3113 1.0E-133
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1243 3350 2.0E-133
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 813 3113 2.0E-133
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 795 3113 5.0E-133
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1178 3986 5.0E-133
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 817 2188 3.0E-131
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 492 2941 8.0E-130
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 163 3029 4.0E-129
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3335 4435 5.0E-129
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 155 2255 7.0E-129
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 817 3113 2.0E-128
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1234 2211 2.0E-128
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 48 2198 7.0E-128
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1213 2188 9.0E-128
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2241 4351 2.0E-127
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 798 3321 7.0E-127
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 496 3029 9.0E-127
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 157 1856 3.0E-124
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 146 2061 5.0E-124
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 157 2194 6.0E-124
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 817 3113 9.0E-124
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 489 3157 4.0E-122
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 489 3157 2.0E-121
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 146 2062 7.0E-121
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1893 4345 1.0E-120
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1897 4188 2.0E-120
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1897 4182 2.0E-119
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 20 1119 4.0E-119
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 216 1851 5.0E-119
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 800 2189 3.0E-118
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 17 2269 4.0E-118
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 224 2062 9.0E-118
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1894 4106 7.0E-117
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1246 4097 7.0E-117
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 124 2144 8.0E-117
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1246 4097 1.0E-116
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 844 3111 3.0E-116
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 146 2062 6.0E-116
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 224 2050 8.0E-116
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1897 3291 2.0E-115
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2948 4343 9.0E-115
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1896 4345 7.0E-114
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1892 4345 1.0E-112
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 3396 4363 2.0E-111
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 157 2145 1.0E-109
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 238 1855 2.0E-109
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1266 3026 6.0E-109
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 59 2186 6.0E-109
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 202 1850 9.0E-109
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3140 4388 1.0E-108
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1892 3990 3.0E-108
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 485 1242 5.0E-108
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1154 4235 7.0E-108
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1884 3161 8.0E-107
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2962 4336 1.0E-106
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1897 4012 4.0E-106
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 166 2034 3.0E-105
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 155 1095 1.0E-104
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2083 3270 1.0E-104
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 177 1142 1.0E-104
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1893 4097 3.0E-104
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2969 4342 5.0E-104
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 496 2136 9.0E-104
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 146 1854 2.0E-103
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1997 4325 1.0E-102
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1897 4097 3.0E-102
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1895 4365 1.0E-101
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1897 3990 2.0E-101
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 146 1854 8.0E-100
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2318 4004 1.0E-99
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1897 4097 2.0E-99
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1241 2932 5.0E-99
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 37 1144 3.0E-98
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1205 1854 3.0E-98
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2318 3295 5.0E-98
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1879 3993 6.0E-98
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1031 1978 2.0E-97
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 496 1918 6.0E-97
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1896 3997 1.0E-95
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3375 4326 8.0E-95
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 768 1765 6.0E-94
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 495 2067 9.0E-94
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 496 2288 2.0E-93
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 854 2952 4.0E-92
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2283 4364 5.0E-91
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1991 3989 9.0E-91
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2234 4217 3.0E-88
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1269 3111 1.0E-87
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2916 4350 2.0E-87
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2969 4364 6.0E-87
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1897 4339 8.0E-87
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3339 4372 2.0E-86
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 705 2179 2.0E-86
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 778 1875 2.0E-86
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2933 3904 1.0E-85
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 496 2172 3.0E-85
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1237 2939 4.0E-85
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 149 887 6.0E-85
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 778 2054 5.0E-84
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3348 4101 2.0E-83
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2293 4377 2.0E-83
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2970 4364 3.0E-83
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 710 2192 5.0E-83
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2293 4377 9.0E-83
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 240 1878 7.0E-82
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 147 1132 9.0E-82
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 147 1132 1.0E-81
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2967 4368 1.0E-80
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 204 777 2.0E-79
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 816 1855 3.0E-79
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 3384 4001 3.0E-79
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 815 1856 4.0E-78
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 164 1132 2.0E-77
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 817 1854 4.0E-77
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2967 4365 4.0E-77
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1210 2027 9.0E-77
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2962 4365 2.0E-75
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2914 4369 2.0E-75
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2962 4365 7.0E-75
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2346 4332 8.0E-75
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 813 1855 4.0E-74
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 492 1859 5.0E-73
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2290 3108 3.0E-72
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2966 4375 8.0E-71
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2008 3996 2.0E-70
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2265 2915 3.0E-70
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2965 4343 1.0E-69
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 703 1851 6.0E-69
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2966 4355 5.0E-68
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2968 4368 8.0E-68
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2927 3990 1.0E-66
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1893 2846 3.0E-66
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 489 1707 2.0E-65
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1247 1856 7.0E-65
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2316 3990 6.0E-64
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3698 4363 3.0E-63
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1269 2049 3.0E-63
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2949 3998 4.0E-63
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 811 1854 4.0E-63
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1037 1855 5.0E-63
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2301 3108 1.0E-62
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2855 4365 1.0E-62
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1242 2049 1.0E-62
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2968 4364 2.0E-62
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1242 2049 2.0E-62
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 513 2186 1.0E-60
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2994 3993 2.0E-60
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 854 1682 3.0E-60
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2950 3996 3.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3399 4342 5.0E-58
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 891 1855 2.0E-57
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1795 3276 6.0E-57
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 164 957 2.0E-56
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 146 783 5.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2970 4002 1.0E-55
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2962 3996 3.0E-54
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 196 1090 6.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 146 781 7.0E-54
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1799 2931 8.0E-54
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2334 4343 1.0E-53
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 227 1100 6.0E-53
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1893 2930 1.0E-52
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 17 693 2.0E-52
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 219 947 4.0E-52
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 224 965 7.0E-52
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1281 2188 2.0E-51
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 224 965 3.0E-51
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1894 2931 5.0E-51
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2819 4366 9.0E-51
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1227 2054 1.0E-50
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 238 1112 2.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 146 777 3.0E-50
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 173 1115 1.0E-49
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3090 4345 1.0E-48
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 822 1858 2.0E-48
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 95 1084 3.0E-48
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 198 474 2.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 95 775 2.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3070 4355 3.0E-47
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2642 3285 1.0E-46
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1921 2931 1.0E-46
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2970 4002 3.0E-46
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2320 3167 4.0E-46
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1261 2059 7.0E-46
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1880 2932 2.0E-45
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1893 2941 3.0E-45
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1535 2189 1.0E-44
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1386 2937 2.0E-44
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 157 777 3.0E-44
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3859 4365 4.0E-44
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1897 2942 4.0E-44
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3377 4000 7.0E-44
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 165 487 7.0E-44
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 822 1869 9.0E-44
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 822 1829 2.0E-43
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 146 782 3.0E-43
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2319 3113 3.0E-43
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2319 3113 4.0E-43
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 146 777 5.0E-43
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 3382 4207 7.0E-43
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 238 959 1.0E-42
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 3090 4431 1.0E-42
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 3397 4240 2.0E-42
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2793 4034 3.0E-42
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 211 777 1.0E-41
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 224 774 2.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3409 3993 2.0E-41
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 3397 4240 3.0E-41
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 132 1119 1.0E-40
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 18 488 2.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 146 1136 3.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1246 1862 3.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1246 1862 3.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1246 1862 3.0E-40
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1805 3233 4.0E-40
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3071 3993 4.0E-40
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 490 1132 6.0E-40
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1242 1862 8.0E-40
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 146 1115 2.0E-39
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 157 1068 5.0E-39
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2058 2936 9.0E-39
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2941 4345 1.0E-38
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 251 777 1.0E-38
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2238 3113 2.0E-38
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1178 1829 2.0E-38
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 86 780 6.0E-38
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2316 2927 7.0E-38
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1268 1859 1.0E-37
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1268 1859 1.0E-37
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 160 1122 2.0E-37
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 160 1122 3.0E-37
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1256 1764 5.0E-37
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1246 1864 1.0E-36
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 225 1146 2.0E-36
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1178 1858 2.0E-36
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1266 1764 3.0E-36
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1266 1764 3.0E-36
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1266 1764 3.0E-36
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1266 1764 3.0E-36
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3409 3993 5.0E-36
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 3404 3998 6.0E-36
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1257 1764 7.0E-36
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1257 1764 7.0E-36
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 146 611 9.0E-36
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1261 1863 9.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1266 1764 1.0E-35
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3302 4005 2.0E-35
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1256 1764 2.0E-35
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1256 1698 2.0E-35
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1266 1764 2.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1266 1764 3.0E-35
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1266 1764 4.0E-35
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1247 1758 5.0E-35
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1247 1758 5.0E-35
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1247 1758 5.0E-35
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1247 1758 5.0E-35
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1247 1758 7.0E-35
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1247 1758 7.0E-35
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1247 1758 7.0E-35
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1234 1698 1.0E-34
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1234 1698 1.0E-34
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1234 1698 1.0E-34
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1234 1698 1.0E-34
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1180 1852 1.0E-34
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1269 1855 1.0E-34
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1247 1758 1.0E-34
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1247 1758 1.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1265 1663 1.0E-34
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1247 1758 1.0E-34
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1249 1758 2.0E-34
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1256 1701 2.0E-34
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1256 1701 2.0E-34
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1234 1663 2.0E-34
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1256 1701 3.0E-34
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2319 3141 4.0E-34
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1234 1698 5.0E-34
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1234 1698 5.0E-34
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1255 1758 7.0E-34
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 226 1114 8.0E-34
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 238 775 9.0E-34
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1257 1758 9.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1269 1760 1.0E-33
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2008 2918 2.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1257 1758 2.0E-33
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 496 1098 4.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1270 1663 2.0E-32
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1184 1855 3.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1263 1855 3.0E-32
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1983 2756 4.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1307 1663 6.0E-32
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1269 1761 7.0E-32
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1269 1758 8.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1269 1758 8.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1269 1758 1.0E-31
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1269 1758 2.0E-31
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 497 968 8.0E-31
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3406 4308 9.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3911 4351 1.0E-30
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 613 1085 1.0E-30
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2304 2855 3.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1261 1764 4.0E-30
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 496 1130 5.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1258 1760 5.0E-30
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2788 3236 7.0E-30
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 3349 4375 2.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1259 1761 2.0E-29
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 854 1879 2.0E-29
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1260 1760 2.0E-29
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 913 1717 4.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1259 1761 4.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1259 1761 5.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1259 1761 5.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1259 1761 5.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1259 1761 5.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1259 1761 5.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1259 1761 5.0E-29
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2836 3270 6.0E-29
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 723 1214 6.0E-29
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 211 474 7.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1259 1761 9.0E-29
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 219 774 1.0E-28
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3415 4327 2.0E-28
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1269 1760 2.0E-28
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3420 4443 2.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1269 1760 2.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1588 2180 3.0E-27
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2972 3832 3.0E-27
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 160 681 6.0E-27
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1804 2175 8.0E-27
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 494 777 3.0E-26
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2325 2929 4.0E-26
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 220 448 5.0E-26
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2312 2928 2.0E-25
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 493 786 3.0E-25
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 499 779 3.0E-25
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2345 3297 1.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1796 2216 2.0E-24
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 492 967 2.0E-24
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 238 687 2.0E-24
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 95 449 4.0E-24
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 95 449 4.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 238 687 4.0E-24
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1268 1872 4.0E-24
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 492 960 6.0E-24
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 3222 4004 7.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1787 2724 9.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3419 4407 9.0E-24
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 3397 3997 1.0E-23
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2312 2929 1.0E-23
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2312 2929 1.0E-23
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 146 470 2.0E-23
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 96 620 2.0E-23
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 3409 4004 2.0E-23
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 3409 3964 5.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1269 1760 8.0E-23
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1984 2932 1.0E-22
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 3420 4110 2.0E-22
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1925 2932 4.0E-22
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 224 448 8.0E-22
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1911 2932 8.0E-22
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 224 448 9.0E-22
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 3399 4000 9.0E-22
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 3399 4000 1.0E-21
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 3399 4000 1.0E-21
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2003 2905 1.0E-21
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 496 783 2.0E-21
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 504 785 5.0E-21
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 504 785 5.0E-21
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 504 785 5.0E-21
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 238 687 1.0E-20
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 236 684 1.0E-20
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 3316 4020 1.0E-20
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 144 452 2.0E-20
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 225 753 2.0E-20
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 236 684 2.0E-20
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 236 684 2.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 811 1269 4.0E-20
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 157 442 4.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2875 3288 4.0E-20
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 3419 4034 4.0E-20
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 204 683 4.0E-20
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 236 684 5.0E-20
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 89 449 6.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1296 1829 6.0E-20
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 238 687 7.0E-20
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 238 687 7.0E-20
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 238 687 7.0E-20
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 238 687 7.0E-20
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 238 687 7.0E-20
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 226 682 7.0E-20
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1377 1664 8.0E-20
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 238 687 9.0E-20
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 238 687 9.0E-20
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 238 687 9.0E-20
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 238 687 9.0E-20
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 238 687 9.0E-20
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 225 449 2.0E-19
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 190 470 2.0E-19
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 238 687 2.0E-19
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 3297 4010 2.0E-19
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 3350 3891 2.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2880 3301 3.0E-19
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2345 2938 3.0E-19
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2345 2938 3.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 733 1211 5.0E-19
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 496 777 7.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 702 1099 8.0E-19
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 476 777 9.0E-19
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 504 777 1.0E-18
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 504 777 1.0E-18
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1247 1760 1.0E-18
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 146 474 3.0E-18
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 480 777 4.0E-18
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 238 682 5.0E-18
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1395 1825 7.0E-18
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1782 2192 9.0E-18
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 226 682 1.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1858 2211 2.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2870 3232 2.0E-17
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 117 470 2.0E-17
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 147 448 2.0E-17
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 146 488 3.0E-17
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 147 448 3.0E-17
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 498 783 4.0E-17
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 498 777 4.0E-17
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2781 3107 5.0E-17
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 95 470 6.0E-17
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 3409 3982 6.0E-17
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 3409 3982 6.0E-17
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 223 448 7.0E-17
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 498 777 8.0E-17
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 476 784 8.0E-17
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2969 3309 9.0E-17
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1247 1760 9.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2968 3305 2.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 706 1119 2.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 737 1214 2.0E-16
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 3330 3986 2.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1897 2177 3.0E-16
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 227 442 3.0E-16
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 474 800 4.0E-16
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 474 777 7.0E-16
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 88 485 8.0E-16
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 166 470 1.0E-15
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 147 485 1.0E-15
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2309 2928 1.0E-15
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2309 2928 1.0E-15
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2309 2928 1.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2968 3237 2.0E-15
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 222 474 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 4034 4364 2.0E-15
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 209 487 2.0E-15
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2003 2964 2.0E-15
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 251 683 4.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4065 4436 5.0E-15
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1701 2054 5.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1248 1664 6.0E-15
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2338 2937 9.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4031 4384 1.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 708 1140 1.0E-14
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2358 2913 1.0E-14
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 3703 3964 1.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2854 3235 2.0E-14
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 4065 4377 2.0E-14
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 426 687 2.0E-14
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 497 687 2.0E-14
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2316 2948 2.0E-14
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2320 2842 2.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 857 1112 3.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 146 438 3.0E-14
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 146 438 3.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 4059 4342 3.0E-14
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 186 467 3.0E-14
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 497 687 3.0E-14
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 472 742 3.0E-14
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 186 467 4.0E-14
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 1269 1764 5.0E-14
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 504 749 6.0E-14
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1269 1769 8.0E-14
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1269 1769 8.0E-14
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 1268 1764 9.0E-14
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 504 785 1.0E-13
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 3405 3998 1.0E-13
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 501 687 1.0E-13
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 239 485 2.0E-13
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 186 467 2.0E-13
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2342 2839 2.0E-13
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 239 485 3.0E-13
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 501 681 3.0E-13
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 1268 1764 4.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 202 485 5.0E-13
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 4058 4370 7.0E-13
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 1269 1764 7.0E-13
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 3421 3891 8.0E-13
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 238 485 1.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4044 4369 1.0E-12
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3858 4201 1.0E-12
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 501 775 1.0E-12
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 3421 3891 1.0E-12
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 3421 3891 1.0E-12
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 213 469 2.0E-12
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 226 592 2.0E-12
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 4059 4376 4.0E-12
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 225 474 4.0E-12
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2322 2932 4.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1389 1758 4.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3869 4308 8.0E-12
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1262 1677 8.0E-12
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 498 679 9.0E-12
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 4064 4375 1.0E-11
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 3409 3903 1.0E-11
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 498 677 1.0E-11
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2326 2842 1.0E-11
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 501 681 1.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1268 1879 1.0E-11
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1247 1767 1.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2871 3270 2.0E-11
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 229 444 2.0E-11
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 3526 3900 2.0E-11
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 1389 1974 2.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3853 3996 3.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3405 3818 3.0E-11
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 204 473 3.0E-11
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 204 473 3.0E-11
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 498 679 3.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 641 781 4.0E-11
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 204 473 5.0E-11
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 204 473 5.0E-11
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 204 473 5.0E-11
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 3409 3903 7.0E-11
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 1268 1764 7.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 719 1104 8.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2319 2785 8.0E-11
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2700 2899 8.0E-11
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3853 3996 8.0E-11
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 3409 3903 1.0E-10
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 3409 3903 1.0E-10
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 497 681 1.0E-10
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3374 3990 1.0E-10
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1268 1694 1.0E-10
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 3409 3903 2.0E-10
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 3409 3903 2.0E-10
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 496 683 2.0E-10
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 496 683 2.0E-10
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 496 683 2.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1262 1664 2.0E-10
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 220 474 3.0E-10
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 220 474 3.0E-10
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 3409 3903 3.0E-10
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 3409 3903 3.0E-10
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 3409 3903 3.0E-10
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 501 681 3.0E-10
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 501 681 3.0E-10
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 3419 3891 3.0E-10
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2324 2842 3.0E-10
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 3612 3984 3.0E-10
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1293 1760 3.0E-10
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1244 1664 3.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 4059 4359 4.0E-10
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 3409 3903 4.0E-10
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1233 1664 4.0E-10
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 253 681 5.0E-10
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 253 681 5.0E-10
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 253 681 5.0E-10
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2792 3048 5.0E-10
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 3409 3903 6.0E-10
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 253 681 6.0E-10
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 253 681 6.0E-10
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2280 2744 7.0E-10
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 3405 3900 8.0E-10
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4058 4346 9.0E-10
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 496 777 9.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4032 4335 1.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 4059 4328 1.0E-09
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 4055 4327 1.0E-09
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 496 683 1.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1361 1760 1.0E-09
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1390 1844 1.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3924 4363 2.0E-09
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 3421 3897 2.0E-09
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 3410 3895 2.0E-09
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1261 1765 2.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1293 1664 2.0E-09
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 3421 3891 3.0E-09
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 238 473 3.0E-09
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3387 4000 3.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 250 474 3.0E-09
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1293 1759 3.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1261 1758 3.0E-09
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3815 4097 4.0E-09
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1384 1664 4.0E-09
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 3503 3900 6.0E-09
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 3423 3900 7.0E-09
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 3423 3900 7.0E-09
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 3503 3900 8.0E-09
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 212 449 1.0E-08
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 238 473 1.0E-08
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 3423 3900 1.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 1235 1664 1.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 4065 4368 2.0E-08
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 238 473 2.0E-08
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 238 473 2.0E-08
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2343 2839 2.0E-08
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 3421 3891 2.0E-08
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 3421 3891 2.0E-08
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 3421 3891 2.0E-08
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 228 473 2.0E-08
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1293 1760 2.0E-08
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2320 2844 3.0E-08
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 3716 3993 4.0E-08
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 3421 3891 4.0E-08
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 3421 3891 4.0E-08
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 498 683 4.0E-08
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 498 683 5.0E-08
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 498 683 5.0E-08
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1723 1957 5.0E-08
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2758 2935 5.0E-08
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4049 4327 7.0E-08
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 1269 1677 7.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4055 4368 8.0E-08
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 3423 3900 8.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1293 1760 9.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 1382 1771 9.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3885 4350 1.0E-07
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2464 2839 1.0E-07
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1390 1661 1.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1293 1760 1.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1389 1780 1.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1387 1760 1.0E-07
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2320 2839 2.0E-07
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 479 677 2.0E-07
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2346 2839 2.0E-07
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 1264 1410 2.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1394 1771 2.0E-07
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 3613 3832 2.0E-07
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 479 677 3.0E-07
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 479 677 3.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1248 1667 3.0E-07
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2343 2839 4.0E-07
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2320 2839 4.0E-07
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2343 2839 4.0E-07
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2324 2839 4.0E-07
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 3423 3900 4.0E-07
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 1386 1678 4.0E-07
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1259 1695 4.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 501 685 4.0E-07
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 479 677 5.0E-07
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 479 677 5.0E-07
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 479 677 5.0E-07
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 479 677 5.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2771 2928 6.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 495 590 6.0E-07
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 1251 1661 6.0E-07
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 1251 1661 6.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1388 1661 6.0E-07
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 234 473 7.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1247 1664 7.0E-07
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2320 2839 8.0E-07
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2320 2839 8.0E-07
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 3423 3900 8.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 3665 3903 8.0E-07
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1262 1760 9.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 4058 4335 1.0E-06
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3882 4328 1.0E-06
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2343 2839 1.0E-06
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2346 2839 1.0E-06
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 3420 3897 1.0E-06
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 1266 1410 1.0E-06
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1388 1668 1.0E-06
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2334 2843 1.0E-06
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1560 1766 1.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1293 1664 1.0E-06
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3716 4009 2.0E-06
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 213 449 2.0E-06
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 213 449 2.0E-06
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 213 449 2.0E-06
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2343 2839 2.0E-06
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 637 898 2.0E-06
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1389 1762 2.0E-06
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 1269 1762 2.0E-06
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1270 1664 2.0E-06
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 501 681 3.0E-06
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1388 1668 3.0E-06
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 238 499 4.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2455 2841 4.0E-06
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 1371 1760 4.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4068 4336 5.0E-06
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2706 2899 5.0E-06
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 292 476 6.0E-06
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 1252 1763 6.0E-06
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1388 1692 6.0E-06
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1394 1692 6.0E-06
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1388 1692 8.0E-06
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1388 1692 8.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 1260 1762 8.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 1260 1762 8.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 1260 1762 8.0E-06
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1388 1692 8.0E-06
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1388 1692 8.0E-06
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1277 1770 9.0E-06
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1388 1692 9.0E-06
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 1261 1410 1.0E-05
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 1261 1410 1.0E-05
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 1261 1410 1.0E-05
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1388 1692 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1873
MASNASKEGDESRPSLEMAPCLFPTLNGRDDDLNSSRCLALPLPVDALLAFSEQHRFKLLQATWALVLQSYTGTD
SPSFMSRHGSCWLHTCLDLSEDVELLQIVESISTEKVDSSSHGLADRVNTAVEWESLDIGRRQCRGEPEPRFDVS
LHARGTGEDWSVCLRYKPAMLSEIQADEVGSVIAHIVAQMLQGPVRLSAIDTCTRHTVETLKAWNRRRPETISRC
IHHVVLDNCSAYPDSAAVCAWDGDFSYRDLDNLTATLSRHLISRGIGAEKFVGIYTDKSKWTVIGILSVLRAGGA
FTLLDTSFPASRIAIMCEKLQVELLLCSDERFDEASAFNLPVLQVDDELMNRLSSEALPTRLELSVSVTPENAAL
AVFTSGSTGIPKGIVFNHTSVCSGQSATIARVGYGPGTRALQFASYAFDLSVQEHLTPLMAGACVCIPSETARKS
KLDEAIRQMGVNLAVLTPTVSRLLQPAEVGTLKKLLLAVNPSDREKLLPIGGVGELLIQGPIVGRGYVGDKDQTE
SRFISAPGWRCRFPVLEGTHDKLYCTGDLVQYVGDGMLRYIGRRDSQVKIHGQRLELAEVERGLLEMLPEGCHAL
ATVVHPADDSSPVLAGFVLSPGNVGSEGQVFADASPQFRQLAERVMTDLAGRLPLFMIPSVLIPLTTIPTSRSGK
GDRRVLASLASAYTRRELYAFCKDTAGQLQSPTTKNEELLHQAVEQVLGVNNFSMGDNFFSLGGDSVRAMLLARQ
TREAAGLEVTVENILKSATLSELASTMCPSRESVDIAPFSLLSGQDSVEETLSRARSCCRLSSVDDVEDIYPCTA
LQEGITALSMSSHEAKYVTSSTYRLPRAVDVQRLRRAWDSVVASNPVLRTRILQSATGQVLQAVLKTAVEWEVVA
DLAELERLQRQWRVEIGGPLLRLAMVSTSRGNYFSVFISHALYDGWSLPETLKQVEAAYHGETISSKPFKHFVSH
VLASDEAQARQFWLESLKHYSAQPFPSAPAGQLQYRPAALQTLRRSVSIPDSRSPEWTLSTAILLAWAVTVSQYT
GSDDVCFGTTLSGRNTALSGVDRILGPTITTIPLRTQLDRTQTVQNVLSSLHRWLQDSIPHQHLGTQRIASLGTE
AAAASRFHNHLVIQPPPSDETSTIFADGDTWEVVDNYMLALQVILPKPVSDVLCVEVSYDDTAVSQWKMTRIADQ
FCHNVLQILSNPSKTFRDLDDMDFAGRRIIMDWNRRLPDVVDCCAHDLISRRCLGQAASPAVDAFDGSLTYGQLD
EQTTQLAAHLQEKGAGPGTYVMIMLERSLWAVVAILAVMKSGAAFVVVDLSTPDSRLEQIRDETEPILAITSPLN
VGRATELHLPVVIAHHGSSWLAAGGEQQMFKPPSVSSQDIVYAVFTSGSTGRPKGIAVPHRALATGASISGRSLT
LGPGSRALHASSYAFDASIAEIIYTLVQGGCVCVPSEADSRNCLEDAIGRFHIDWASLTPSLTRALNPAKMSTIR
TLIWGGEAVTRADVEMWPQSMQLINAYGPAECTIDSTFQHNVSLSSPANIGYGFATVTWIVDPDDPTCGSLVPLG
AVGELVLEGPVVAEGYLNNPTKTASSFVNYPDWLKQLRRGQPGRLYRTGDLVQYSPSGDGSLLYLGRKDNQVKLR
GQRLELEEVEQHLMDCLPAAKAVVAEIVKPCDAGAAPALAAFILLDGVSSDETGDEILASGDSPLCAQLGIAEAR
MASRVPRFMVPGLYLPLLRLPTSVAGKANRRLLREMASALTRKQLKAYSSSALQPQAPSTVKDRALHEGVCEVLK
LPPLEVGVNSNFFQLGGDSITAMKLAGRLQDAGFSLSVADVFKHGTLESLAATLEENRFDQDSFSRTIPAFALLP
EAQRRDTIQAVARECGVSLDDIEDVYPCTPMQEGLLSLTMKQPGQYVAELIFDLPPETDLARVRTAWDAVYAANA
ILRSRVVTLRSGSGSSLQAVVREPLSWSSTLDPLIVDHGKPLLKVVLNEQDGRLHLWLHHALYDGVSLPILFEQA
EAAYQGASSLPSSSFNAFAAYMEKLDAAAGRRFWTKEFRDLDTVLFPTSTRLQQPSASAGERESLSCSISIPDMN
GLEFTLPSVIHAACAATLGHFAHTRDVVYGLTLTGRNAPVVGIDGLVGPTITTVPFRVQLRPSMTARALLSSIQE
HLVSIMPYEQMGLQATRSINSECATACDFQCSVVIQPTDDETVKKKRIFGEPQTSSDEDSLFSSSPLALEFTVSS
DRRSVHMVANFEVSVLDRGDASSFARHLEKTIQQIVKDADSQVQDLQEAGPHDLQRIESCNGSFRPTVDKLVQDL
VKEQCRSRPGAEAVSSWDGSWTYSEVEDASSRLSKHLMSRGVSTGPVTAVYMDKSRWIVVAILSVLKSGSACVLL
DNDYSEEQMRDMLRQTGAASILTSPEKGRMAESIAGGKGAAVIVVSTALLHSPPPSPPHSPKTIHSSDAAFAVFS
SPGSAGKVDGMMLDHAAVTTGLRDLCGPHGLDETSRVLHCSSFASRAGLFEILGCLAVGGCLCIPSEQDCNVSRL
GDFIESYGVNWAGLMSSAAGSIEPKLVPSLKTLMVRGEVVRSADVNRWAAARDDVRLVNSYSLRECPMICAVGRI
LPEEWTPGLIGPVVGGIGWVVNPDDYSRLCAVGAVGELMIESPVRSRRCAGDDYQLESSCIASPAWLSRIRGHGG
SRLYRTGDLVQYTSRLDIRYLGRREADVKLSGRRVHLQEMESILMKHMPSDAVVVVDFVTTTTGRCQLFAFIQLP
HQKQATDSKEGSLFSEPDQDFLSLCRAAKQSLSGLLSRDMMPTAFIPLTRFPRTTSGKINRRLLREKARDLRTPD
LDLAKQPMSEDEINMARLWADVLQLPADEFCATDSFFHVGGDSIAAMKLVAAARERGLTVTVPEIFSHPHLADMA
SVVESSKQQQASSPDVAPFSLLPGDEREAVLEAAERLCRVQRADIEDCYPCTPMQEALFSQSMRSDGAFTAHFRY
KLEPGVDVSRFQTAWERVMERNPVLRTRIVSTRAFYQVVLTRPAAWEVVDEDALEEAASGLCGNEVQLGCPLLRL
LICPQSIEPEFCLVIHHALYDGWSLDLVLDQVQRTYKEQPLLVSQPWNHFIRYLGEQDQEAGRKHWLTQLSGATG
AVFPALPAPDFKPFTDCIIRQEVKLEALPDVTRAAVLEFCWAVTASQYCKATGVSYGLVQSGRDVGVQGIESMTG
PTIATIPVHLTLHKDEPVIQALRRLQGQRAAATPFQHFGLQNIRRLSRQTEAACRFQSLLLIQHAAAAAPDEEAE
KLFTLVADGDDEAGNFSAHALEVVCEMTDDSSCVVEFHFDSSVLDPRQARRVLGQYVWFVEQVQSKSTHELSHLD
LVSPSAKREMMEWNSVLPKVVDGCVHDGIQYQVDAEAVCAWDGSFTYRQLDALSSGLSLHLRSIGVGPETFVPVL
CEKSKWVSVAILAVVRAGGAIVFLDGDDDLPRLRSICGSVDAGVVLSSQDFSTMAREIASSVIIIEQAPCEASST
NLVSTVASDNALYAVFDSDSQQGAVVSHGAFLTAFSTQKLSLDIDGDARTLQFAPHVSPTCIVDYLWTFLTGGCV
CVASEDRLRHDVADAVCEFRVSRAEFTPSVVRTLRLDDMPTLMTVVLRHEALSKHEMHAWAAKVRLVYAYGLSET
SGYCSLTDADVDSDPSTIGRAQSLLSWIVDRNKHDLLLPVGSVGELVLEGHALARGHLEAPELSSSSSFIDITPS
WLRGSRTDTRLLRTGVLARYNPDGSLCYCGRKDAQVRVKDQLVNLEEIERQVREVAVSVRDVVAEAVLSTDKDVG
QLLAVFVTGLTDVDGQEAASGFLSASQKHRDEAQRVTELLNGRLPSNMVPDVIIPLARLPARTNGKTPRQLLRVE
AAALTKEQVEQYQPGLSVKRAPESELQKTLQVVVADVLGLDLEDFSIDDSFFRLGGDSIIAIRLVERARSKGFTF
RVSDVFQSPKLSDLSRFVASGEESAVTNGTTSSSELIGKVDKGELVMGLAAKGFPCTENDVDAILPVTQAAERYL
LQTPEYWIINLRGAVDVEGLERACSDLVLRHGILRSVFVSDQGRFLQLVLSRMKTIVRHFQTTLAIADFVEDHRR
RDVMKLPTLDMPLTEFLFVQSSANEEPRKALVLRLSHAQFDGYCLLTLWQDLKQLYEGGSLPPAVPYSLHLQQWK
QSHTDDGFAFWRDTLKGSSIARIDNTTFGDEAISLEDSEFVTTSRLIHIGESLPRNTTAATIVKAAWAVVLARLS
GHNDGVFAQASNGRSYDSAKDVVGMCLNFIPVRSSVDAAATVPELVDAMQRQHHQSLAHELIDFDEIVRRSTSWA
EGSRHQTVLLHQNLDPDEEFCLGEAEAWVTCCYEWPHPPDEILIESFPKGGGKLLMTMDTRSNVLSKGNADAVMD
RLCRLIGLVARLAGDSGARVGGLLEAVG*
Coding >Ophun1|1873
ATGGCGTCCAACGCGAGTAAGGAGGGCGACGAGAGCAGGCCATCGCTGGAAATGGCTCCGTGCTTGTTTCCCACC
CTGAATGGACGAGATGATGATCTGAATTCGAGCCGCTGCCTTGCTCTCCCGCTTCCTGTCGACGCCCTCCTCGCC
TTCAGTGAGCAGCATCGCTTCAAGCTGCTGCAAGCAACATGGGCCCTGGTGCTCCAGTCTTATACCGGCACCGAC
AGCCCGTCCTTCATGTCGCGTCATGGCAGTTGCTGGCTTCACACGTGCTTGGACTTGTCGGAGGATGTCGAGCTT
CTGCAAATCGTGGAATCCATCAGCACAGAAAAGGTCGACTCTTCCAGCCATGGCTTGGCGGATCGAGTAAATACG
GCCGTAGAATGGGAGTCTCTCGACATCGGAAGACGTCAATGTCGAGGGGAGCCCGAGCCTCGCTTCGACGTGAGC
CTCCATGCTCGCGGAACAGGCGAGGATTGGTCCGTCTGCCTGCGTTACAAACCTGCCATGCTCAGCGAGATCCAA
GCCGATGAAGTCGGGTCAGTAATAGCGCATATCGTGGCCCAGATGCTTCAGGGGCCCGTCCGTCTCAGCGCCATC
GACACGTGCACCCGTCACACCGTCGAAACGCTCAAGGCCTGGAACAGGAGGCGACCGGAGACGATAAGCCGCTGC
ATCCACCACGTGGTGCTCGACAACTGCAGCGCCTATCCGGACTCGGCTGCCGTCTGTGCCTGGGACGGCGACTTT
AGCTACCGTGACCTTGACAATCTGACGGCGACGCTGTCACGGCACCTTATCTCTCGGGGGATCGGGGCGGAAAAG
TTCGTCGGCATCTATACCGACAAGTCGAAGTGGACCGTCATCGGCATCTTATCTGTCCTGCGGGCCGGCGGTGCT
TTCACCCTGTTGGATACGTCGTTTCCGGCATCTCGCATTGCCATCATGTGTGAGAAGCTGCAGGTTGAGTTGCTC
CTCTGCTCGGATGAGCGGTTTGACGAGGCATCGGCTTTCAACCTACCCGTACTGCAGGTCGACGATGAGCTCATG
AACAGACTCTCTTCGGAAGCCCTCCCGACACGACTGGAGCTCTCCGTCTCCGTCACGCCGGAAAATGCCGCCTTG
GCCGTCTTCACCTCGGGATCGACAGGTATCCCAAAGGGCATCGTCTTCAACCACACCTCCGTCTGCTCCGGACAG
TCGGCCACCATCGCCAGAGTCGGTTACGGCCCCGGGACAAGAGCTCTGCAGTTTGCGTCGTACGCCTTCGACCTC
AGTGTACAGGAGCATCTGACGCCGCTGATGGCGGGGGCTTGCGTCTGTATCCCGTCTGAGACGGCTCGCAAGTCC
AAGCTGGATGAGGCCATACGGCAGATGGGCGTCAACCTTGCCGTGTTGACTCCCACCGTCTCTCGTCTCCTCCAG
CCGGCTGAAGTTGGCACTTTGAAAAAGTTGTTGCTCGCGGTCAATCCGTCTGACCGGGAGAAGCTCTTACCGATA
GGCGGTGTCGGCGAGCTCCTGATCCAGGGACCCATTGTCGGAAGAGGATACGTTGGAGACAAGGACCAGACCGAG
TCCCGGTTCATCTCGGCACCCGGCTGGCGTTGTCGGTTTCCTGTTCTCGAGGGAACTCACGACAAGCTGTACTGC
ACGGGTGACCTCGTGCAATATGTAGGAGACGGCATGTTGCGGTATATTGGGCGTCGAGACTCGCAAGTCAAAATC
CACGGACAACGGCTGGAGTTGGCCGAGGTGGAGCGCGGCCTGCTCGAGATGCTCCCCGAGGGATGCCATGCTCTC
GCTACCGTCGTTCATCCTGCCGACGATTCATCGCCTGTTCTAGCCGGCTTCGTTTTGTCCCCGGGGAATGTCGGC
AGCGAAGGCCAAGTATTCGCTGATGCATCTCCTCAGTTCCGGCAGCTGGCCGAACGCGTCATGACCGATCTCGCC
GGCCGGCTGCCCCTATTCATGATCCCATCTGTGTTGATACCCCTGACGACCATCCCGACGAGCCGGAGCGGAAAG
GGTGATAGGCGAGTCTTGGCCAGTCTGGCATCCGCTTACACCAGGAGGGAGCTGTATGCTTTCTGCAAGGACACT
GCTGGCCAACTCCAGTCGCCGACGACCAAGAATGAAGAACTGCTTCACCAAGCCGTCGAGCAGGTTCTTGGCGTC
AACAACTTTAGCATGGGCGACAACTTCTTCAGCCTGGGCGGAGACTCGGTACGGGCCATGCTGCTGGCACGGCAG
ACGAGAGAGGCCGCGGGACTGGAAGTGACGGTAGAAAACATCCTCAAGAGCGCCACACTGTCAGAACTGGCATCG
ACCATGTGTCCCAGTCGAGAATCGGTCGATATCGCTCCCTTCTCGCTTCTCTCGGGCCAGGACTCGGTAGAGGAG
ACGCTCAGCAGGGCCCGTTCGTGCTGCCGGCTGTCGAGCGTCGACGACGTCGAGGACATTTATCCCTGCACAGCA
CTGCAGGAAGGCATCACAGCCTTATCCATGTCAAGCCACGAGGCCAAGTACGTCACATCATCGACCTATCGGCTG
CCGCGGGCCGTCGACGTCCAACGGCTGAGGCGTGCGTGGGACTCGGTTGTAGCGAGCAACCCGGTTCTGCGGACG
CGGATCCTGCAGAGCGCCACCGGACAGGTGCTTCAGGCGGTGCTCAAGACGGCTGTCGAGTGGGAGGTGGTCGCA
GATCTCGCCGAGTTGGAGCGCCTGCAGCGGCAATGGCGAGTCGAGATCGGAGGTCCGCTCCTCCGGCTGGCAATG
GTCTCGACGAGCCGGGGCAACTATTTTTCCGTCTTCATCTCTCATGCCCTCTACGACGGCTGGTCGCTGCCCGAG
ACGCTGAAGCAGGTCGAAGCAGCCTATCACGGGGAGACGATATCGTCCAAGCCCTTCAAACACTTCGTCAGCCAT
GTCCTGGCATCGGACGAGGCTCAGGCCCGCCAGTTCTGGCTCGAGAGCCTCAAGCATTACTCGGCTCAGCCCTTC
CCCAGTGCTCCGGCCGGGCAGCTGCAGTATCGGCCGGCGGCTCTGCAGACGCTGAGACGCTCCGTGTCTATCCCG
GACTCTCGCTCGCCGGAATGGACCCTTTCCACTGCCATCCTGCTCGCCTGGGCCGTGACCGTCTCTCAGTACACG
GGCTCTGATGACGTTTGCTTCGGGACGACGCTCTCCGGGAGAAATACTGCCCTCTCAGGGGTGGACCGTATCCTC
GGTCCGACCATCACGACGATTCCATTGAGGACGCAGCTCGATCGGACACAGACGGTACAGAATGTCCTCTCCTCT
TTGCATCGATGGCTCCAGGACTCGATTCCGCACCAGCATCTCGGCACCCAGCGTATAGCGTCGCTTGGGACTGAA
GCTGCGGCTGCTTCTCGGTTTCACAACCACCTCGTCATCCAGCCGCCTCCGTCGGACGAGACATCGACCATCTTC
GCCGACGGGGATACCTGGGAAGTGGTGGATAACTATATGCTGGCACTGCAGGTTATCCTCCCCAAGCCGGTGTCT
GATGTCCTGTGTGTCGAGGTCAGCTACGATGACACGGCTGTTTCGCAATGGAAGATGACCAGGATCGCGGATCAG
TTCTGTCACAATGTGCTCCAGATCCTATCCAACCCTTCCAAGACATTCCGTGATCTTGACGATATGGACTTTGCA
GGGCGGCGCATCATTATGGACTGGAACCGTCGGCTTCCCGATGTAGTCGACTGCTGCGCCCACGACCTCATCAGT
CGCCGGTGCCTCGGTCAAGCCGCAAGCCCTGCAGTCGATGCCTTTGATGGCAGCCTGACATATGGTCAGCTCGAC
GAACAGACGACCCAGCTCGCGGCACACCTTCAAGAAAAAGGGGCTGGTCCCGGGACTTACGTCATGATCATGCTG
GAGCGCTCCCTCTGGGCTGTCGTCGCCATCCTGGCCGTCATGAAGTCTGGAGCCGCATTCGTCGTCGTGGACTTG
TCGACGCCGGATTCACGTCTGGAGCAGATTCGCGACGAGACGGAGCCGATACTGGCCATCACTTCGCCTCTGAAC
GTAGGGAGAGCAACGGAGCTGCATCTACCGGTCGTCATCGCCCATCATGGCTCGAGCTGGCTGGCGGCTGGCGGA
GAGCAGCAAATGTTCAAACCCCCGTCCGTATCGTCTCAAGACATTGTCTATGCCGTCTTCACCTCCGGATCGACA
GGCAGGCCCAAGGGCATCGCCGTTCCACACCGGGCGTTGGCCACGGGTGCCAGTATCAGCGGACGGTCGCTTACG
CTGGGACCTGGCAGTAGGGCCCTGCATGCGTCGTCGTACGCCTTTGACGCCTCCATCGCGGAGATCATCTACACC
TTGGTTCAGGGTGGGTGCGTCTGCGTTCCGTCCGAGGCGGACAGTCGGAACTGCCTCGAAGACGCCATCGGCCGC
TTCCACATCGACTGGGCCAGTCTGACGCCGTCTCTGACGAGGGCCCTGAACCCTGCCAAGATGTCAACGATACGG
ACCTTGATCTGGGGTGGCGAGGCCGTCACCCGGGCCGACGTCGAGATGTGGCCTCAGAGTATGCAGCTCATCAAT
GCCTACGGCCCGGCCGAGTGTACCATCGACAGCACCTTTCAGCACAACGTATCCCTGAGCAGCCCTGCCAACATC
GGCTACGGCTTCGCCACCGTGACCTGGATTGTCGACCCGGACGACCCGACGTGCGGTAGCTTGGTGCCCCTGGGA
GCCGTCGGGGAACTGGTGCTTGAAGGCCCTGTAGTGGCCGAGGGATACCTCAACAATCCCACCAAGACGGCCTCG
TCCTTCGTCAACTATCCAGACTGGCTGAAGCAGCTCCGACGCGGGCAGCCTGGCCGGCTATACCGGACGGGTGAC
TTGGTCCAGTACAGCCCATCTGGCGATGGATCACTTCTGTATCTGGGCCGCAAGGACAACCAGGTCAAGCTCCGT
GGGCAGAGACTTGAGCTCGAGGAGGTGGAACAGCATCTGATGGACTGCCTGCCCGCAGCCAAGGCCGTCGTCGCC
GAGATCGTCAAGCCGTGCGATGCCGGTGCCGCTCCCGCCCTTGCTGCCTTCATCCTCCTCGACGGTGTATCATCA
GACGAGACGGGAGACGAGATACTCGCGTCAGGTGACTCGCCTCTATGCGCACAGCTCGGTATCGCAGAGGCCCGC
ATGGCGTCCCGCGTGCCGAGGTTCATGGTTCCGGGCCTGTACCTCCCCCTGCTCCGGCTGCCGACGTCGGTGGCC
GGCAAGGCGAACCGGAGGTTGCTGCGAGAGATGGCCTCGGCTCTGACCAGGAAGCAACTCAAGGCGTACAGTTCG
AGCGCGCTGCAGCCGCAGGCCCCGTCAACGGTGAAGGATAGAGCGCTGCACGAGGGCGTGTGTGAGGTTCTCAAG
CTGCCGCCGTTGGAAGTTGGCGTGAACAGCAACTTCTTCCAGCTGGGAGGCGACTCCATCACGGCCATGAAGCTG
GCTGGACGGCTGCAGGACGCTGGGTTCTCCTTGTCTGTTGCCGATGTCTTCAAACACGGTACGCTGGAGAGCCTG
GCTGCAACGCTGGAAGAGAATAGATTCGACCAAGACAGCTTTTCCAGGACGATTCCGGCGTTTGCGCTGCTTCCC
GAGGCACAACGTCGGGACACGATTCAGGCGGTTGCTCGAGAATGCGGAGTCTCCTTGGACGATATTGAAGACGTC
TACCCTTGCACGCCGATGCAGGAAGGCCTACTGTCCCTGACTATGAAGCAGCCAGGTCAGTACGTGGCCGAGTTG
ATCTTTGACCTGCCGCCGGAGACGGACCTCGCCCGCGTCAGAACCGCATGGGATGCCGTTTACGCCGCCAATGCC
ATCCTGCGAAGCCGCGTCGTGACGCTACGGTCTGGCTCAGGTTCGTCGTTGCAAGCCGTCGTCAGGGAGCCTCTC
TCCTGGAGCTCGACCCTCGACCCGCTCATTGTCGACCATGGGAAGCCGCTTCTAAAGGTTGTGCTCAACGAACAA
GATGGAAGACTGCATCTATGGTTGCACCACGCGCTGTACGATGGTGTCTCGTTGCCGATTCTCTTTGAGCAAGCC
GAGGCGGCGTATCAGGGAGCTTCGTCGTTGCCAAGTTCGTCGTTCAACGCCTTTGCCGCATACATGGAGAAGCTC
GACGCGGCTGCGGGCCGACGTTTCTGGACCAAAGAGTTCCGAGATCTCGATACCGTTCTGTTTCCGACCAGCACG
AGATTACAACAGCCCTCTGCTTCGGCAGGCGAGCGGGAGTCTCTGTCGTGCAGCATCTCCATTCCGGACATGAAC
GGGCTGGAGTTTACGCTCCCATCCGTTATCCACGCCGCCTGCGCCGCAACGCTCGGACACTTTGCTCACACGCGA
GACGTCGTCTACGGGCTCACTCTGACGGGAAGAAATGCCCCCGTTGTGGGCATCGACGGCCTCGTCGGTCCAACC
ATCACGACAGTCCCTTTCCGGGTTCAACTGAGGCCGTCAATGACGGCGAGGGCCCTGCTGTCGAGCATACAGGAG
CACCTGGTGAGCATCATGCCTTACGAGCAGATGGGACTACAAGCGACGCGGTCCATCAACTCCGAGTGCGCGACG
GCGTGCGACTTCCAATGCTCCGTGGTGATTCAGCCGACCGACGATGAGACGGTGAAGAAGAAGAGAATCTTTGGC
GAGCCGCAAACCAGCAGCGACGAAGACTCGCTGTTCTCCAGCTCGCCGCTTGCCCTGGAATTCACCGTCTCCAGC
GATAGGCGCTCTGTTCATATGGTGGCCAACTTTGAAGTTTCGGTTCTAGATAGGGGCGACGCGTCGAGTTTTGCC
CGCCACCTCGAAAAGACGATTCAGCAGATCGTAAAGGACGCGGATTCGCAGGTGCAAGACCTTCAAGAAGCCGGC
CCGCATGACCTACAGCGCATCGAAAGCTGCAACGGATCATTCCGGCCTACAGTCGACAAGCTGGTGCAGGACCTG
GTCAAGGAGCAATGCCGCTCAAGGCCCGGAGCCGAGGCCGTCTCCTCGTGGGACGGATCGTGGACGTACAGCGAG
GTCGAAGACGCCAGTTCACGCCTGTCGAAACACCTGATGAGCCGAGGTGTCAGTACCGGTCCCGTCACGGCCGTC
TACATGGACAAGTCGCGGTGGATTGTTGTTGCCATTCTATCGGTCCTCAAGTCGGGCTCGGCCTGCGTCCTGCTC
GACAACGACTACTCGGAAGAGCAGATGAGAGACATGCTGAGGCAGACGGGTGCCGCTTCGATTCTCACGTCTCCC
GAGAAAGGCAGGATGGCGGAGAGTATCGCGGGCGGAAAAGGGGCTGCTGTCATCGTCGTGTCTACAGCCTTGCTG
CACAGCCCGCCACCGAGTCCGCCGCACTCACCCAAGACCATCCACAGCTCCGACGCCGCTTTCGCCGTCTTCTCT
TCGCCGGGGAGCGCAGGCAAGGTAGACGGCATGATGCTCGACCACGCTGCTGTGACGACGGGGCTGAGAGACCTA
TGCGGGCCGCATGGCTTGGACGAGACATCGAGGGTACTGCATTGCTCTTCTTTCGCCTCTCGTGCAGGTCTGTTT
GAGATTCTCGGTTGTCTAGCGGTTGGTGGTTGCCTGTGCATCCCGTCTGAGCAGGACTGCAACGTCTCTCGTCTC
GGAGACTTTATCGAGAGCTACGGCGTCAACTGGGCGGGACTGATGTCGTCCGCCGCCGGCAGCATTGAACCCAAG
CTCGTTCCATCTCTCAAGACGCTGATGGTCAGGGGTGAAGTCGTCCGATCGGCAGACGTCAACCGCTGGGCGGCT
GCTCGAGATGACGTCCGCCTCGTCAACTCGTACAGCCTGCGGGAGTGCCCCATGATCTGCGCCGTCGGCCGCATA
CTTCCCGAGGAATGGACCCCGGGTCTCATCGGCCCCGTCGTCGGCGGCATCGGCTGGGTTGTGAACCCGGATGAC
TACTCGAGGCTCTGTGCCGTCGGCGCCGTTGGAGAACTGATGATTGAGAGCCCCGTGCGGTCTCGTCGGTGCGCC
GGAGACGACTATCAGTTGGAATCGAGCTGTATCGCCAGCCCGGCTTGGCTGTCACGGATCCGTGGCCATGGCGGG
AGCCGGCTGTATCGGACGGGCGACCTGGTGCAATACACGAGCCGGCTTGACATTCGCTACCTGGGTCGAAGGGAG
GCGGACGTGAAGCTCAGCGGCAGACGCGTACATTTGCAGGAGATGGAGAGTATTCTCATGAAACACATGCCGTCT
GACGCTGTCGTCGTCGTCGATTTTGTCACGACCACCACTGGTCGTTGTCAGCTCTTCGCCTTTATACAGCTCCCT
CATCAGAAGCAGGCCACAGACAGCAAAGAAGGAAGCCTATTCTCCGAACCAGACCAAGACTTTCTGAGCCTCTGT
CGCGCCGCAAAACAGAGCCTCAGTGGGTTGTTATCGCGCGACATGATGCCCACCGCCTTCATTCCCCTGACTCGG
TTTCCCCGTACGACCAGCGGCAAGATCAACCGTCGCCTGCTTCGTGAAAAGGCCCGTGATCTTCGGACGCCTGAT
CTCGACCTGGCCAAGCAGCCGATGAGCGAGGATGAGATTAACATGGCTCGGCTCTGGGCCGATGTGCTCCAACTT
CCCGCAGACGAGTTCTGCGCAACAGACAGTTTCTTCCACGTCGGCGGTGACTCCATCGCAGCCATGAAGCTCGTT
GCCGCGGCTCGAGAGCGAGGCCTGACCGTGACGGTGCCCGAGATCTTCTCTCATCCGCACTTGGCTGACATGGCG
TCGGTGGTCGAGAGTTCAAAACAGCAGCAGGCGTCGTCCCCTGACGTCGCGCCCTTTTCTTTGCTGCCAGGAGAC
GAGAGAGAAGCGGTGCTGGAGGCGGCAGAGAGGTTGTGTCGCGTTCAGAGAGCAGACATCGAAGACTGCTATCCG
TGTACGCCGATGCAGGAGGCGCTCTTCTCGCAGTCGATGCGTTCCGACGGCGCTTTCACGGCCCATTTCCGATAC
AAGCTCGAGCCGGGCGTCGATGTGTCTCGATTCCAGACGGCGTGGGAGCGGGTCATGGAGCGGAACCCGGTGCTT
CGGACGCGAATTGTCTCGACGCGGGCCTTTTACCAGGTCGTGCTGACGCGGCCTGCTGCGTGGGAGGTTGTCGAC
GAAGACGCACTGGAGGAGGCTGCCTCGGGGCTTTGCGGGAACGAGGTCCAGCTGGGATGCCCGCTGCTTCGTCTT
CTGATATGCCCGCAGAGTATCGAGCCCGAGTTCTGTCTCGTCATTCATCATGCGCTGTATGACGGCTGGTCGCTG
GACCTTGTCTTGGATCAAGTGCAGCGGACTTACAAGGAGCAGCCTCTTCTCGTCTCTCAGCCCTGGAATCACTTC
ATCCGTTACCTCGGCGAGCAGGATCAGGAGGCCGGACGCAAACACTGGCTCACTCAGCTATCTGGCGCAACTGGA
GCCGTCTTTCCAGCCTTGCCTGCACCCGACTTCAAGCCCTTTACCGACTGCATCATTCGCCAGGAGGTCAAGCTT
GAGGCTCTCCCGGATGTGACGCGCGCCGCTGTTCTCGAGTTCTGCTGGGCCGTTACCGCGTCTCAGTATTGTAAA
GCAACAGGTGTCTCCTATGGCCTCGTCCAGTCCGGCCGTGACGTCGGCGTACAGGGCATCGAATCCATGACTGGA
CCGACGATAGCGACTATTCCTGTTCATCTCACTCTCCACAAAGACGAGCCCGTCATCCAAGCGCTGCGTCGTCTC
CAAGGTCAGAGGGCGGCCGCCACGCCGTTCCAGCATTTCGGCTTGCAGAACATCCGCCGGCTGAGCCGTCAGACC
GAGGCGGCTTGCAGGTTCCAGAGCCTGCTGTTGATTCAGCACGCCGCAGCTGCTGCCCCTGACGAAGAAGCCGAG
AAGCTCTTTACGCTGGTGGCGGACGGCGACGATGAGGCTGGCAACTTTAGCGCTCATGCGCTGGAGGTTGTATGC
GAGATGACGGACGACAGCAGCTGCGTGGTCGAGTTCCACTTTGACTCGAGCGTTCTTGATCCGCGACAGGCGAGG
CGAGTTCTGGGCCAGTATGTTTGGTTCGTCGAGCAGGTCCAGTCGAAGTCGACGCACGAACTCTCGCACCTGGAC
CTCGTCTCTCCCTCGGCGAAGCGGGAGATGATGGAGTGGAACTCGGTGCTCCCGAAAGTTGTCGATGGCTGTGTT
CACGACGGCATCCAATACCAGGTCGATGCCGAGGCAGTCTGTGCGTGGGACGGCAGCTTCACTTATCGTCAGCTC
GACGCCTTGTCTTCTGGCCTCTCGCTGCACCTCCGAAGCATCGGCGTCGGTCCCGAGACGTTCGTTCCCGTTCTG
TGCGAGAAGAGCAAGTGGGTGTCGGTCGCCATTCTCGCTGTCGTCAGAGCTGGCGGCGCCATCGTCTTTCTCGAC
GGAGACGATGATTTGCCACGGCTGAGATCCATCTGTGGAAGCGTCGATGCCGGGGTTGTCTTGTCTTCCCAAGAC
TTTTCGACCATGGCTCGAGAAATAGCTTCGTCTGTCATCATCATCGAACAAGCTCCCTGCGAGGCCAGCTCGACG
AATCTTGTATCAACAGTTGCTTCTGACAACGCCTTGTACGCAGTCTTTGACTCGGACTCGCAACAGGGGGCTGTG
GTGAGCCACGGAGCCTTCTTGACTGCCTTTTCGACACAAAAGCTTTCTCTTGATATCGACGGCGATGCTCGGACG
CTTCAATTCGCACCGCACGTGTCTCCGACGTGTATCGTCGACTACCTCTGGACCTTTTTGACGGGCGGTTGCGTC
TGTGTTGCTTCTGAAGATCGTCTGCGGCATGATGTTGCAGATGCCGTCTGCGAATTCCGTGTCAGTCGAGCCGAG
TTTACTCCATCCGTTGTGCGCACCCTTCGCCTCGACGATATGCCGACGTTGATGACCGTCGTCCTGCGTCACGAG
GCTCTATCGAAGCACGAGATGCATGCGTGGGCTGCCAAGGTTCGGCTTGTATACGCCTACGGTTTGTCGGAGACT
TCTGGGTACTGCTCTCTGACAGATGCCGACGTTGACTCGGATCCTTCGACTATCGGCCGCGCGCAAAGCCTCCTT
TCCTGGATTGTCGACAGGAATAAACACGATCTTCTCCTCCCCGTTGGCTCTGTTGGTGAGCTGGTGCTCGAAGGA
CATGCCTTGGCTCGTGGCCATCTCGAGGCGCCAGAATTGTCGTCGTCGTCCTCCTTCATCGATATCACGCCTTCT
TGGCTGCGAGGCTCGCGAACCGACACGAGGCTGTTGAGGACGGGCGTGTTGGCTCGGTACAACCCGGATGGAAGC
CTCTGCTACTGTGGTCGCAAGGACGCTCAGGTGCGGGTCAAGGACCAGCTGGTCAATCTCGAGGAGATTGAGCGC
CAGGTTCGAGAGGTTGCTGTGTCGGTCCGTGACGTCGTTGCCGAGGCTGTGCTTTCGACGGACAAGGACGTCGGC
CAGCTTCTTGCTGTCTTTGTTACGGGCTTGACGGATGTTGATGGCCAGGAGGCTGCTTCGGGTTTCCTTTCCGCC
AGTCAGAAGCATCGCGATGAGGCGCAGAGAGTGACGGAGCTGCTGAATGGTCGACTCCCGAGCAACATGGTCCCA
GACGTCATCATTCCTCTCGCCCGTCTTCCGGCTCGAACAAACGGCAAGACTCCTCGCCAGTTGTTACGCGTCGAA
GCAGCAGCCCTCACGAAGGAGCAAGTCGAGCAATACCAGCCAGGCCTCTCGGTCAAGAGAGCGCCAGAGTCGGAG
CTGCAGAAGACGCTTCAGGTGGTTGTTGCCGACGTCTTGGGCCTCGACCTCGAAGACTTTAGCATAGACGACAGC
TTCTTCCGGCTTGGAGGCGACTCCATCATCGCCATTCGACTCGTCGAACGGGCCCGGTCCAAGGGCTTCACGTTT
CGCGTCTCTGACGTGTTCCAGAGCCCGAAGCTGTCTGATCTGTCCCGGTTCGTGGCCAGTGGAGAGGAGAGCGCT
GTGACGAACGGAACGACCAGCTCGTCGGAGCTAATTGGGAAGGTAGACAAGGGAGAGTTGGTGATGGGATTGGCT
GCCAAGGGGTTTCCGTGCACGGAGAATGACGTCGATGCGATTCTACCGGTTACGCAGGCGGCTGAGCGCTATCTT
CTCCAGACGCCGGAGTATTGGATCATCAACCTGCGAGGGGCGGTCGATGTTGAAGGGCTGGAACGAGCGTGTTCC
GACTTGGTTCTTCGACACGGGATCCTGCGGTCCGTCTTTGTATCGGATCAGGGCCGATTCCTGCAGCTCGTCTTG
TCTCGGATGAAGACCATCGTCAGACACTTCCAGACGACGCTCGCCATTGCCGACTTTGTCGAAGATCATCGCCGC
AGGGACGTGATGAAGCTGCCGACGCTCGACATGCCGTTGACCGAGTTTCTGTTCGTGCAGAGCAGCGCGAATGAG
GAACCGCGAAAGGCTCTCGTTCTGCGGTTGAGCCACGCGCAGTTTGATGGCTACTGTCTCCTGACGCTCTGGCAG
GATCTCAAGCAGCTGTACGAAGGTGGCAGCCTTCCTCCCGCCGTGCCCTACTCTCTTCACCTGCAGCAGTGGAAG
CAGAGCCATACGGACGATGGCTTCGCTTTCTGGAGGGATACGCTGAAGGGCTCGTCGATTGCTCGCATTGATAAT
ACCACCTTTGGTGATGAGGCCATCTCTCTTGAAGACTCCGAGTTCGTCACCACCTCTCGACTCATCCATATCGGA
GAATCTCTCCCTCGCAACACGACGGCGGCTACCATTGTCAAGGCTGCCTGGGCCGTGGTTCTTGCCCGTCTCTCG
GGTCACAACGACGGCGTCTTCGCGCAGGCGTCCAACGGACGAAGCTACGACTCGGCCAAGGACGTGGTCGGCATG
TGCCTCAACTTCATCCCCGTGCGATCGAGCGTCGACGCGGCGGCGACGGTGCCGGAGCTGGTAGACGCCATGCAG
CGGCAGCACCACCAGAGTCTCGCGCACGAGCTCATCGACTTTGACGAGATTGTGCGGCGTTCGACGTCCTGGGCG
GAGGGGAGCAGGCATCAGACGGTGCTGCTGCATCAGAACCTCGACCCGGATGAGGAGTTTTGCCTGGGCGAGGCG
GAGGCGTGGGTTACGTGCTGCTACGAGTGGCCTCATCCGCCGGACGAGATTCTGATTGAGTCGTTTCCAAAGGGA
GGGGGGAAGCTGCTGATGACGATGGATACGAGGAGTAATGTGCTGAGCAAGGGGAATGCGGATGCTGTTATGGAT
AGGCTGTGTCGTTTGATTGGGCTGGTTGCGCGGTTGGCGGGCGATTCGGGGGCGAGGGTTGGGGGTTTGTTGGAG
GCTGTTGGGTGA
Transcript >Ophun1|1873
ATGGCGTCCAACGCGAGTAAGGAGGGCGACGAGAGCAGGCCATCGCTGGAAATGGCTCCGTGCTTGTTTCCCACC
CTGAATGGACGAGATGATGATCTGAATTCGAGCCGCTGCCTTGCTCTCCCGCTTCCTGTCGACGCCCTCCTCGCC
TTCAGTGAGCAGCATCGCTTCAAGCTGCTGCAAGCAACATGGGCCCTGGTGCTCCAGTCTTATACCGGCACCGAC
AGCCCGTCCTTCATGTCGCGTCATGGCAGTTGCTGGCTTCACACGTGCTTGGACTTGTCGGAGGATGTCGAGCTT
CTGCAAATCGTGGAATCCATCAGCACAGAAAAGGTCGACTCTTCCAGCCATGGCTTGGCGGATCGAGTAAATACG
GCCGTAGAATGGGAGTCTCTCGACATCGGAAGACGTCAATGTCGAGGGGAGCCCGAGCCTCGCTTCGACGTGAGC
CTCCATGCTCGCGGAACAGGCGAGGATTGGTCCGTCTGCCTGCGTTACAAACCTGCCATGCTCAGCGAGATCCAA
GCCGATGAAGTCGGGTCAGTAATAGCGCATATCGTGGCCCAGATGCTTCAGGGGCCCGTCCGTCTCAGCGCCATC
GACACGTGCACCCGTCACACCGTCGAAACGCTCAAGGCCTGGAACAGGAGGCGACCGGAGACGATAAGCCGCTGC
ATCCACCACGTGGTGCTCGACAACTGCAGCGCCTATCCGGACTCGGCTGCCGTCTGTGCCTGGGACGGCGACTTT
AGCTACCGTGACCTTGACAATCTGACGGCGACGCTGTCACGGCACCTTATCTCTCGGGGGATCGGGGCGGAAAAG
TTCGTCGGCATCTATACCGACAAGTCGAAGTGGACCGTCATCGGCATCTTATCTGTCCTGCGGGCCGGCGGTGCT
TTCACCCTGTTGGATACGTCGTTTCCGGCATCTCGCATTGCCATCATGTGTGAGAAGCTGCAGGTTGAGTTGCTC
CTCTGCTCGGATGAGCGGTTTGACGAGGCATCGGCTTTCAACCTACCCGTACTGCAGGTCGACGATGAGCTCATG
AACAGACTCTCTTCGGAAGCCCTCCCGACACGACTGGAGCTCTCCGTCTCCGTCACGCCGGAAAATGCCGCCTTG
GCCGTCTTCACCTCGGGATCGACAGGTATCCCAAAGGGCATCGTCTTCAACCACACCTCCGTCTGCTCCGGACAG
TCGGCCACCATCGCCAGAGTCGGTTACGGCCCCGGGACAAGAGCTCTGCAGTTTGCGTCGTACGCCTTCGACCTC
AGTGTACAGGAGCATCTGACGCCGCTGATGGCGGGGGCTTGCGTCTGTATCCCGTCTGAGACGGCTCGCAAGTCC
AAGCTGGATGAGGCCATACGGCAGATGGGCGTCAACCTTGCCGTGTTGACTCCCACCGTCTCTCGTCTCCTCCAG
CCGGCTGAAGTTGGCACTTTGAAAAAGTTGTTGCTCGCGGTCAATCCGTCTGACCGGGAGAAGCTCTTACCGATA
GGCGGTGTCGGCGAGCTCCTGATCCAGGGACCCATTGTCGGAAGAGGATACGTTGGAGACAAGGACCAGACCGAG
TCCCGGTTCATCTCGGCACCCGGCTGGCGTTGTCGGTTTCCTGTTCTCGAGGGAACTCACGACAAGCTGTACTGC
ACGGGTGACCTCGTGCAATATGTAGGAGACGGCATGTTGCGGTATATTGGGCGTCGAGACTCGCAAGTCAAAATC
CACGGACAACGGCTGGAGTTGGCCGAGGTGGAGCGCGGCCTGCTCGAGATGCTCCCCGAGGGATGCCATGCTCTC
GCTACCGTCGTTCATCCTGCCGACGATTCATCGCCTGTTCTAGCCGGCTTCGTTTTGTCCCCGGGGAATGTCGGC
AGCGAAGGCCAAGTATTCGCTGATGCATCTCCTCAGTTCCGGCAGCTGGCCGAACGCGTCATGACCGATCTCGCC
GGCCGGCTGCCCCTATTCATGATCCCATCTGTGTTGATACCCCTGACGACCATCCCGACGAGCCGGAGCGGAAAG
GGTGATAGGCGAGTCTTGGCCAGTCTGGCATCCGCTTACACCAGGAGGGAGCTGTATGCTTTCTGCAAGGACACT
GCTGGCCAACTCCAGTCGCCGACGACCAAGAATGAAGAACTGCTTCACCAAGCCGTCGAGCAGGTTCTTGGCGTC
AACAACTTTAGCATGGGCGACAACTTCTTCAGCCTGGGCGGAGACTCGGTACGGGCCATGCTGCTGGCACGGCAG
ACGAGAGAGGCCGCGGGACTGGAAGTGACGGTAGAAAACATCCTCAAGAGCGCCACACTGTCAGAACTGGCATCG
ACCATGTGTCCCAGTCGAGAATCGGTCGATATCGCTCCCTTCTCGCTTCTCTCGGGCCAGGACTCGGTAGAGGAG
ACGCTCAGCAGGGCCCGTTCGTGCTGCCGGCTGTCGAGCGTCGACGACGTCGAGGACATTTATCCCTGCACAGCA
CTGCAGGAAGGCATCACAGCCTTATCCATGTCAAGCCACGAGGCCAAGTACGTCACATCATCGACCTATCGGCTG
CCGCGGGCCGTCGACGTCCAACGGCTGAGGCGTGCGTGGGACTCGGTTGTAGCGAGCAACCCGGTTCTGCGGACG
CGGATCCTGCAGAGCGCCACCGGACAGGTGCTTCAGGCGGTGCTCAAGACGGCTGTCGAGTGGGAGGTGGTCGCA
GATCTCGCCGAGTTGGAGCGCCTGCAGCGGCAATGGCGAGTCGAGATCGGAGGTCCGCTCCTCCGGCTGGCAATG
GTCTCGACGAGCCGGGGCAACTATTTTTCCGTCTTCATCTCTCATGCCCTCTACGACGGCTGGTCGCTGCCCGAG
ACGCTGAAGCAGGTCGAAGCAGCCTATCACGGGGAGACGATATCGTCCAAGCCCTTCAAACACTTCGTCAGCCAT
GTCCTGGCATCGGACGAGGCTCAGGCCCGCCAGTTCTGGCTCGAGAGCCTCAAGCATTACTCGGCTCAGCCCTTC
CCCAGTGCTCCGGCCGGGCAGCTGCAGTATCGGCCGGCGGCTCTGCAGACGCTGAGACGCTCCGTGTCTATCCCG
GACTCTCGCTCGCCGGAATGGACCCTTTCCACTGCCATCCTGCTCGCCTGGGCCGTGACCGTCTCTCAGTACACG
GGCTCTGATGACGTTTGCTTCGGGACGACGCTCTCCGGGAGAAATACTGCCCTCTCAGGGGTGGACCGTATCCTC
GGTCCGACCATCACGACGATTCCATTGAGGACGCAGCTCGATCGGACACAGACGGTACAGAATGTCCTCTCCTCT
TTGCATCGATGGCTCCAGGACTCGATTCCGCACCAGCATCTCGGCACCCAGCGTATAGCGTCGCTTGGGACTGAA
GCTGCGGCTGCTTCTCGGTTTCACAACCACCTCGTCATCCAGCCGCCTCCGTCGGACGAGACATCGACCATCTTC
GCCGACGGGGATACCTGGGAAGTGGTGGATAACTATATGCTGGCACTGCAGGTTATCCTCCCCAAGCCGGTGTCT
GATGTCCTGTGTGTCGAGGTCAGCTACGATGACACGGCTGTTTCGCAATGGAAGATGACCAGGATCGCGGATCAG
TTCTGTCACAATGTGCTCCAGATCCTATCCAACCCTTCCAAGACATTCCGTGATCTTGACGATATGGACTTTGCA
GGGCGGCGCATCATTATGGACTGGAACCGTCGGCTTCCCGATGTAGTCGACTGCTGCGCCCACGACCTCATCAGT
CGCCGGTGCCTCGGTCAAGCCGCAAGCCCTGCAGTCGATGCCTTTGATGGCAGCCTGACATATGGTCAGCTCGAC
GAACAGACGACCCAGCTCGCGGCACACCTTCAAGAAAAAGGGGCTGGTCCCGGGACTTACGTCATGATCATGCTG
GAGCGCTCCCTCTGGGCTGTCGTCGCCATCCTGGCCGTCATGAAGTCTGGAGCCGCATTCGTCGTCGTGGACTTG
TCGACGCCGGATTCACGTCTGGAGCAGATTCGCGACGAGACGGAGCCGATACTGGCCATCACTTCGCCTCTGAAC
GTAGGGAGAGCAACGGAGCTGCATCTACCGGTCGTCATCGCCCATCATGGCTCGAGCTGGCTGGCGGCTGGCGGA
GAGCAGCAAATGTTCAAACCCCCGTCCGTATCGTCTCAAGACATTGTCTATGCCGTCTTCACCTCCGGATCGACA
GGCAGGCCCAAGGGCATCGCCGTTCCACACCGGGCGTTGGCCACGGGTGCCAGTATCAGCGGACGGTCGCTTACG
CTGGGACCTGGCAGTAGGGCCCTGCATGCGTCGTCGTACGCCTTTGACGCCTCCATCGCGGAGATCATCTACACC
TTGGTTCAGGGTGGGTGCGTCTGCGTTCCGTCCGAGGCGGACAGTCGGAACTGCCTCGAAGACGCCATCGGCCGC
TTCCACATCGACTGGGCCAGTCTGACGCCGTCTCTGACGAGGGCCCTGAACCCTGCCAAGATGTCAACGATACGG
ACCTTGATCTGGGGTGGCGAGGCCGTCACCCGGGCCGACGTCGAGATGTGGCCTCAGAGTATGCAGCTCATCAAT
GCCTACGGCCCGGCCGAGTGTACCATCGACAGCACCTTTCAGCACAACGTATCCCTGAGCAGCCCTGCCAACATC
GGCTACGGCTTCGCCACCGTGACCTGGATTGTCGACCCGGACGACCCGACGTGCGGTAGCTTGGTGCCCCTGGGA
GCCGTCGGGGAACTGGTGCTTGAAGGCCCTGTAGTGGCCGAGGGATACCTCAACAATCCCACCAAGACGGCCTCG
TCCTTCGTCAACTATCCAGACTGGCTGAAGCAGCTCCGACGCGGGCAGCCTGGCCGGCTATACCGGACGGGTGAC
TTGGTCCAGTACAGCCCATCTGGCGATGGATCACTTCTGTATCTGGGCCGCAAGGACAACCAGGTCAAGCTCCGT
GGGCAGAGACTTGAGCTCGAGGAGGTGGAACAGCATCTGATGGACTGCCTGCCCGCAGCCAAGGCCGTCGTCGCC
GAGATCGTCAAGCCGTGCGATGCCGGTGCCGCTCCCGCCCTTGCTGCCTTCATCCTCCTCGACGGTGTATCATCA
GACGAGACGGGAGACGAGATACTCGCGTCAGGTGACTCGCCTCTATGCGCACAGCTCGGTATCGCAGAGGCCCGC
ATGGCGTCCCGCGTGCCGAGGTTCATGGTTCCGGGCCTGTACCTCCCCCTGCTCCGGCTGCCGACGTCGGTGGCC
GGCAAGGCGAACCGGAGGTTGCTGCGAGAGATGGCCTCGGCTCTGACCAGGAAGCAACTCAAGGCGTACAGTTCG
AGCGCGCTGCAGCCGCAGGCCCCGTCAACGGTGAAGGATAGAGCGCTGCACGAGGGCGTGTGTGAGGTTCTCAAG
CTGCCGCCGTTGGAAGTTGGCGTGAACAGCAACTTCTTCCAGCTGGGAGGCGACTCCATCACGGCCATGAAGCTG
GCTGGACGGCTGCAGGACGCTGGGTTCTCCTTGTCTGTTGCCGATGTCTTCAAACACGGTACGCTGGAGAGCCTG
GCTGCAACGCTGGAAGAGAATAGATTCGACCAAGACAGCTTTTCCAGGACGATTCCGGCGTTTGCGCTGCTTCCC
GAGGCACAACGTCGGGACACGATTCAGGCGGTTGCTCGAGAATGCGGAGTCTCCTTGGACGATATTGAAGACGTC
TACCCTTGCACGCCGATGCAGGAAGGCCTACTGTCCCTGACTATGAAGCAGCCAGGTCAGTACGTGGCCGAGTTG
ATCTTTGACCTGCCGCCGGAGACGGACCTCGCCCGCGTCAGAACCGCATGGGATGCCGTTTACGCCGCCAATGCC
ATCCTGCGAAGCCGCGTCGTGACGCTACGGTCTGGCTCAGGTTCGTCGTTGCAAGCCGTCGTCAGGGAGCCTCTC
TCCTGGAGCTCGACCCTCGACCCGCTCATTGTCGACCATGGGAAGCCGCTTCTAAAGGTTGTGCTCAACGAACAA
GATGGAAGACTGCATCTATGGTTGCACCACGCGCTGTACGATGGTGTCTCGTTGCCGATTCTCTTTGAGCAAGCC
GAGGCGGCGTATCAGGGAGCTTCGTCGTTGCCAAGTTCGTCGTTCAACGCCTTTGCCGCATACATGGAGAAGCTC
GACGCGGCTGCGGGCCGACGTTTCTGGACCAAAGAGTTCCGAGATCTCGATACCGTTCTGTTTCCGACCAGCACG
AGATTACAACAGCCCTCTGCTTCGGCAGGCGAGCGGGAGTCTCTGTCGTGCAGCATCTCCATTCCGGACATGAAC
GGGCTGGAGTTTACGCTCCCATCCGTTATCCACGCCGCCTGCGCCGCAACGCTCGGACACTTTGCTCACACGCGA
GACGTCGTCTACGGGCTCACTCTGACGGGAAGAAATGCCCCCGTTGTGGGCATCGACGGCCTCGTCGGTCCAACC
ATCACGACAGTCCCTTTCCGGGTTCAACTGAGGCCGTCAATGACGGCGAGGGCCCTGCTGTCGAGCATACAGGAG
CACCTGGTGAGCATCATGCCTTACGAGCAGATGGGACTACAAGCGACGCGGTCCATCAACTCCGAGTGCGCGACG
GCGTGCGACTTCCAATGCTCCGTGGTGATTCAGCCGACCGACGATGAGACGGTGAAGAAGAAGAGAATCTTTGGC
GAGCCGCAAACCAGCAGCGACGAAGACTCGCTGTTCTCCAGCTCGCCGCTTGCCCTGGAATTCACCGTCTCCAGC
GATAGGCGCTCTGTTCATATGGTGGCCAACTTTGAAGTTTCGGTTCTAGATAGGGGCGACGCGTCGAGTTTTGCC
CGCCACCTCGAAAAGACGATTCAGCAGATCGTAAAGGACGCGGATTCGCAGGTGCAAGACCTTCAAGAAGCCGGC
CCGCATGACCTACAGCGCATCGAAAGCTGCAACGGATCATTCCGGCCTACAGTCGACAAGCTGGTGCAGGACCTG
GTCAAGGAGCAATGCCGCTCAAGGCCCGGAGCCGAGGCCGTCTCCTCGTGGGACGGATCGTGGACGTACAGCGAG
GTCGAAGACGCCAGTTCACGCCTGTCGAAACACCTGATGAGCCGAGGTGTCAGTACCGGTCCCGTCACGGCCGTC
TACATGGACAAGTCGCGGTGGATTGTTGTTGCCATTCTATCGGTCCTCAAGTCGGGCTCGGCCTGCGTCCTGCTC
GACAACGACTACTCGGAAGAGCAGATGAGAGACATGCTGAGGCAGACGGGTGCCGCTTCGATTCTCACGTCTCCC
GAGAAAGGCAGGATGGCGGAGAGTATCGCGGGCGGAAAAGGGGCTGCTGTCATCGTCGTGTCTACAGCCTTGCTG
CACAGCCCGCCACCGAGTCCGCCGCACTCACCCAAGACCATCCACAGCTCCGACGCCGCTTTCGCCGTCTTCTCT
TCGCCGGGGAGCGCAGGCAAGGTAGACGGCATGATGCTCGACCACGCTGCTGTGACGACGGGGCTGAGAGACCTA
TGCGGGCCGCATGGCTTGGACGAGACATCGAGGGTACTGCATTGCTCTTCTTTCGCCTCTCGTGCAGGTCTGTTT
GAGATTCTCGGTTGTCTAGCGGTTGGTGGTTGCCTGTGCATCCCGTCTGAGCAGGACTGCAACGTCTCTCGTCTC
GGAGACTTTATCGAGAGCTACGGCGTCAACTGGGCGGGACTGATGTCGTCCGCCGCCGGCAGCATTGAACCCAAG
CTCGTTCCATCTCTCAAGACGCTGATGGTCAGGGGTGAAGTCGTCCGATCGGCAGACGTCAACCGCTGGGCGGCT
GCTCGAGATGACGTCCGCCTCGTCAACTCGTACAGCCTGCGGGAGTGCCCCATGATCTGCGCCGTCGGCCGCATA
CTTCCCGAGGAATGGACCCCGGGTCTCATCGGCCCCGTCGTCGGCGGCATCGGCTGGGTTGTGAACCCGGATGAC
TACTCGAGGCTCTGTGCCGTCGGCGCCGTTGGAGAACTGATGATTGAGAGCCCCGTGCGGTCTCGTCGGTGCGCC
GGAGACGACTATCAGTTGGAATCGAGCTGTATCGCCAGCCCGGCTTGGCTGTCACGGATCCGTGGCCATGGCGGG
AGCCGGCTGTATCGGACGGGCGACCTGGTGCAATACACGAGCCGGCTTGACATTCGCTACCTGGGTCGAAGGGAG
GCGGACGTGAAGCTCAGCGGCAGACGCGTACATTTGCAGGAGATGGAGAGTATTCTCATGAAACACATGCCGTCT
GACGCTGTCGTCGTCGTCGATTTTGTCACGACCACCACTGGTCGTTGTCAGCTCTTCGCCTTTATACAGCTCCCT
CATCAGAAGCAGGCCACAGACAGCAAAGAAGGAAGCCTATTCTCCGAACCAGACCAAGACTTTCTGAGCCTCTGT
CGCGCCGCAAAACAGAGCCTCAGTGGGTTGTTATCGCGCGACATGATGCCCACCGCCTTCATTCCCCTGACTCGG
TTTCCCCGTACGACCAGCGGCAAGATCAACCGTCGCCTGCTTCGTGAAAAGGCCCGTGATCTTCGGACGCCTGAT
CTCGACCTGGCCAAGCAGCCGATGAGCGAGGATGAGATTAACATGGCTCGGCTCTGGGCCGATGTGCTCCAACTT
CCCGCAGACGAGTTCTGCGCAACAGACAGTTTCTTCCACGTCGGCGGTGACTCCATCGCAGCCATGAAGCTCGTT
GCCGCGGCTCGAGAGCGAGGCCTGACCGTGACGGTGCCCGAGATCTTCTCTCATCCGCACTTGGCTGACATGGCG
TCGGTGGTCGAGAGTTCAAAACAGCAGCAGGCGTCGTCCCCTGACGTCGCGCCCTTTTCTTTGCTGCCAGGAGAC
GAGAGAGAAGCGGTGCTGGAGGCGGCAGAGAGGTTGTGTCGCGTTCAGAGAGCAGACATCGAAGACTGCTATCCG
TGTACGCCGATGCAGGAGGCGCTCTTCTCGCAGTCGATGCGTTCCGACGGCGCTTTCACGGCCCATTTCCGATAC
AAGCTCGAGCCGGGCGTCGATGTGTCTCGATTCCAGACGGCGTGGGAGCGGGTCATGGAGCGGAACCCGGTGCTT
CGGACGCGAATTGTCTCGACGCGGGCCTTTTACCAGGTCGTGCTGACGCGGCCTGCTGCGTGGGAGGTTGTCGAC
GAAGACGCACTGGAGGAGGCTGCCTCGGGGCTTTGCGGGAACGAGGTCCAGCTGGGATGCCCGCTGCTTCGTCTT
CTGATATGCCCGCAGAGTATCGAGCCCGAGTTCTGTCTCGTCATTCATCATGCGCTGTATGACGGCTGGTCGCTG
GACCTTGTCTTGGATCAAGTGCAGCGGACTTACAAGGAGCAGCCTCTTCTCGTCTCTCAGCCCTGGAATCACTTC
ATCCGTTACCTCGGCGAGCAGGATCAGGAGGCCGGACGCAAACACTGGCTCACTCAGCTATCTGGCGCAACTGGA
GCCGTCTTTCCAGCCTTGCCTGCACCCGACTTCAAGCCCTTTACCGACTGCATCATTCGCCAGGAGGTCAAGCTT
GAGGCTCTCCCGGATGTGACGCGCGCCGCTGTTCTCGAGTTCTGCTGGGCCGTTACCGCGTCTCAGTATTGTAAA
GCAACAGGTGTCTCCTATGGCCTCGTCCAGTCCGGCCGTGACGTCGGCGTACAGGGCATCGAATCCATGACTGGA
CCGACGATAGCGACTATTCCTGTTCATCTCACTCTCCACAAAGACGAGCCCGTCATCCAAGCGCTGCGTCGTCTC
CAAGGTCAGAGGGCGGCCGCCACGCCGTTCCAGCATTTCGGCTTGCAGAACATCCGCCGGCTGAGCCGTCAGACC
GAGGCGGCTTGCAGGTTCCAGAGCCTGCTGTTGATTCAGCACGCCGCAGCTGCTGCCCCTGACGAAGAAGCCGAG
AAGCTCTTTACGCTGGTGGCGGACGGCGACGATGAGGCTGGCAACTTTAGCGCTCATGCGCTGGAGGTTGTATGC
GAGATGACGGACGACAGCAGCTGCGTGGTCGAGTTCCACTTTGACTCGAGCGTTCTTGATCCGCGACAGGCGAGG
CGAGTTCTGGGCCAGTATGTTTGGTTCGTCGAGCAGGTCCAGTCGAAGTCGACGCACGAACTCTCGCACCTGGAC
CTCGTCTCTCCCTCGGCGAAGCGGGAGATGATGGAGTGGAACTCGGTGCTCCCGAAAGTTGTCGATGGCTGTGTT
CACGACGGCATCCAATACCAGGTCGATGCCGAGGCAGTCTGTGCGTGGGACGGCAGCTTCACTTATCGTCAGCTC
GACGCCTTGTCTTCTGGCCTCTCGCTGCACCTCCGAAGCATCGGCGTCGGTCCCGAGACGTTCGTTCCCGTTCTG
TGCGAGAAGAGCAAGTGGGTGTCGGTCGCCATTCTCGCTGTCGTCAGAGCTGGCGGCGCCATCGTCTTTCTCGAC
GGAGACGATGATTTGCCACGGCTGAGATCCATCTGTGGAAGCGTCGATGCCGGGGTTGTCTTGTCTTCCCAAGAC
TTTTCGACCATGGCTCGAGAAATAGCTTCGTCTGTCATCATCATCGAACAAGCTCCCTGCGAGGCCAGCTCGACG
AATCTTGTATCAACAGTTGCTTCTGACAACGCCTTGTACGCAGTCTTTGACTCGGACTCGCAACAGGGGGCTGTG
GTGAGCCACGGAGCCTTCTTGACTGCCTTTTCGACACAAAAGCTTTCTCTTGATATCGACGGCGATGCTCGGACG
CTTCAATTCGCACCGCACGTGTCTCCGACGTGTATCGTCGACTACCTCTGGACCTTTTTGACGGGCGGTTGCGTC
TGTGTTGCTTCTGAAGATCGTCTGCGGCATGATGTTGCAGATGCCGTCTGCGAATTCCGTGTCAGTCGAGCCGAG
TTTACTCCATCCGTTGTGCGCACCCTTCGCCTCGACGATATGCCGACGTTGATGACCGTCGTCCTGCGTCACGAG
GCTCTATCGAAGCACGAGATGCATGCGTGGGCTGCCAAGGTTCGGCTTGTATACGCCTACGGTTTGTCGGAGACT
TCTGGGTACTGCTCTCTGACAGATGCCGACGTTGACTCGGATCCTTCGACTATCGGCCGCGCGCAAAGCCTCCTT
TCCTGGATTGTCGACAGGAATAAACACGATCTTCTCCTCCCCGTTGGCTCTGTTGGTGAGCTGGTGCTCGAAGGA
CATGCCTTGGCTCGTGGCCATCTCGAGGCGCCAGAATTGTCGTCGTCGTCCTCCTTCATCGATATCACGCCTTCT
TGGCTGCGAGGCTCGCGAACCGACACGAGGCTGTTGAGGACGGGCGTGTTGGCTCGGTACAACCCGGATGGAAGC
CTCTGCTACTGTGGTCGCAAGGACGCTCAGGTGCGGGTCAAGGACCAGCTGGTCAATCTCGAGGAGATTGAGCGC
CAGGTTCGAGAGGTTGCTGTGTCGGTCCGTGACGTCGTTGCCGAGGCTGTGCTTTCGACGGACAAGGACGTCGGC
CAGCTTCTTGCTGTCTTTGTTACGGGCTTGACGGATGTTGATGGCCAGGAGGCTGCTTCGGGTTTCCTTTCCGCC
AGTCAGAAGCATCGCGATGAGGCGCAGAGAGTGACGGAGCTGCTGAATGGTCGACTCCCGAGCAACATGGTCCCA
GACGTCATCATTCCTCTCGCCCGTCTTCCGGCTCGAACAAACGGCAAGACTCCTCGCCAGTTGTTACGCGTCGAA
GCAGCAGCCCTCACGAAGGAGCAAGTCGAGCAATACCAGCCAGGCCTCTCGGTCAAGAGAGCGCCAGAGTCGGAG
CTGCAGAAGACGCTTCAGGTGGTTGTTGCCGACGTCTTGGGCCTCGACCTCGAAGACTTTAGCATAGACGACAGC
TTCTTCCGGCTTGGAGGCGACTCCATCATCGCCATTCGACTCGTCGAACGGGCCCGGTCCAAGGGCTTCACGTTT
CGCGTCTCTGACGTGTTCCAGAGCCCGAAGCTGTCTGATCTGTCCCGGTTCGTGGCCAGTGGAGAGGAGAGCGCT
GTGACGAACGGAACGACCAGCTCGTCGGAGCTAATTGGGAAGGTAGACAAGGGAGAGTTGGTGATGGGATTGGCT
GCCAAGGGGTTTCCGTGCACGGAGAATGACGTCGATGCGATTCTACCGGTTACGCAGGCGGCTGAGCGCTATCTT
CTCCAGACGCCGGAGTATTGGATCATCAACCTGCGAGGGGCGGTCGATGTTGAAGGGCTGGAACGAGCGTGTTCC
GACTTGGTTCTTCGACACGGGATCCTGCGGTCCGTCTTTGTATCGGATCAGGGCCGATTCCTGCAGCTCGTCTTG
TCTCGGATGAAGACCATCGTCAGACACTTCCAGACGACGCTCGCCATTGCCGACTTTGTCGAAGATCATCGCCGC
AGGGACGTGATGAAGCTGCCGACGCTCGACATGCCGTTGACCGAGTTTCTGTTCGTGCAGAGCAGCGCGAATGAG
GAACCGCGAAAGGCTCTCGTTCTGCGGTTGAGCCACGCGCAGTTTGATGGCTACTGTCTCCTGACGCTCTGGCAG
GATCTCAAGCAGCTGTACGAAGGTGGCAGCCTTCCTCCCGCCGTGCCCTACTCTCTTCACCTGCAGCAGTGGAAG
CAGAGCCATACGGACGATGGCTTCGCTTTCTGGAGGGATACGCTGAAGGGCTCGTCGATTGCTCGCATTGATAAT
ACCACCTTTGGTGATGAGGCCATCTCTCTTGAAGACTCCGAGTTCGTCACCACCTCTCGACTCATCCATATCGGA
GAATCTCTCCCTCGCAACACGACGGCGGCTACCATTGTCAAGGCTGCCTGGGCCGTGGTTCTTGCCCGTCTCTCG
GGTCACAACGACGGCGTCTTCGCGCAGGCGTCCAACGGACGAAGCTACGACTCGGCCAAGGACGTGGTCGGCATG
TGCCTCAACTTCATCCCCGTGCGATCGAGCGTCGACGCGGCGGCGACGGTGCCGGAGCTGGTAGACGCCATGCAG
CGGCAGCACCACCAGAGTCTCGCGCACGAGCTCATCGACTTTGACGAGATTGTGCGGCGTTCGACGTCCTGGGCG
GAGGGGAGCAGGCATCAGACGGTGCTGCTGCATCAGAACCTCGACCCGGATGAGGAGTTTTGCCTGGGCGAGGCG
GAGGCGTGGGTTACGTGCTGCTACGAGTGGCCTCATCCGCCGGACGAGATTCTGATTGAGTCGTTTCCAAAGGGA
GGGGGGAAGCTGCTGATGACGATGGATACGAGGAGTAATGTGCTGAGCAAGGGGAATGCGGATGCTGTTATGGAT
AGGCTGTGTCGTTTGATTGGGCTGGTTGCGCGGTTGGCGGGCGATTCGGGGGCGAGGGTTGGGGGTTTGTTGGAG
GCTGTTGGGTGA
Gene >Ophun1|1873
ATGGCGTCCAACGCGAGTAAGGAGGGCGACGAGAGCAGGCCATCGCTGGAAATGGCTCCGTGCTTGTTTCCCACC
CTGAATGGACGAGATGATGATCTGAATTCGAGCCGCTGCCTTGCTCTCCCGCTTCCTGTCGACGCCCTCCTCGCC
TTCAGTGAGCAGCATCGCTTCAAGCTGCTGCAAGCAACATGGGCCCTGGTGCTCCAGTCTTATACCGGCACCGAC
AGCCCGTCCTTCATGTCGCGTCATGGCAGTTGCTGGCTTCACACGTGCTTGGACTTGTCGGAGGATGTCGAGCTT
CTGCAAATCGTGGAATCCATCAGCACAGAAAAGGTCGACTCTTCCAGCCATGGCTTGGCGGATCGAGTAAATACG
GCCGTAGAATGGGAGTCTCTCGACATCGGAAGACGTCAATGTCGAGGGGAGCCCGAGCCTCGCTTCGACGTGAGC
CTCCATGCTCGCGGAACAGGCGAGGATTGGTCCGTCTGCCTGCGTTACAAACCTGCCATGCTCAGCGAGATCCAA
GCCGATGAAGTCGGGTCAGTAATAGCGCATATCGTGGCCCAGATGCTTCAGGGGCCCGTCCGTCTCAGCGCCATC
GACACGTGCACCCGTCACACCGTCGAAACGCTCAAGGCCTGGAACAGGAGGCGACCGGAGACGATAAGCCGCTGC
ATCCACCACGTGGTGCTCGACAACTGCAGCGCCTATCCGGACTCGGCTGCCGTCTGTGCCTGGGACGGCGACTTT
AGCTACCGTGACCTTGACAATCTGACGGCGACGCTGTCACGGCACCTTATCTCTCGGGGGATCGGGGCGGAAAAG
TTCGTCGGCATCTATACCGACAAGTCGAAGTGGACCGTCATCGGCATCTTATCTGTCCTGCGGGCCGGCGGTGCT
TTCACCCTGTTGGATACGTCGTTTCCGGCATCTCGCATTGCCATCATGTGTGAGAAGCTGCAGGTTGAGTTGCTC
CTCTGCTCGGATGAGCGGTTTGACGAGGCATCGGCTTTCAACCTACCCGTACTGCAGGTCGACGATGAGCTCATG
AACAGACTCTCTTCGGAAGCCCTCCCGACACGACTGGAGCTCTCCGTCTCCGTCACGCCGGAAAATGCCGCCTTG
GCCGTCTTCACCTCGGGATCGACAGGTATCCCAAAGGGCATCGTCTTCAACCACACCTCCGTCTGCTCCGGACAG
TCGGCCACCATCGCCAGAGTCGGTTACGGCCCCGGGACAAGAGCTCTGCAGTTTGCGTCGTACGCCTTCGACCTC
AGTGTACAGGAGCATCTGACGCCGCTGATGGCGGGGGCTTGCGTCTGTATCCCGTCTGAGACGGCTCGCAAGTCC
AAGCTGGATGAGGCCATACGGCAGATGGGCGTCAACCTTGCCGTGTTGACTCCCACCGTCTCTCGTCTCCTCCAG
CCGGCTGAAGTTGGCACTTTGAAAAAGTTGTTGCTCGCGGGTGAGCGGCTAATCGAATCTGATGTTGCAGCGTGG
GCTGGTCGTCTGCAGGTATTCAACGGATACGGCCCTGCTGAATGTTGCTTCTATTCCACCTTTCACTTGTTCGGG
CACGACAATCTCGGTCCAAACGTCATAGGCCGTGGCGTTGGGTCGCTCTGCTGGGTAGTCAATCCGTCTGACCGG
GAGAAGCTCTTACCGATAGGCGGTGTCGGCGAGCTCCTGATCCAGGGACCCATTGTCGGAAGAGGATACGTTGGA
GACAAGGACCAGACCGAGTCCCGGTTCATCTCGGCACCCGGCTGGCGTTGTCGGTTTCCTGTTCTCGAGGGAACT
CACGACAAGCTGTACTGCACGGGTGACCTCGTGCAATATGTAGGAGACGGCATGTTGCGGTATATTGGGCGTCGA
GACTCGCAAGTCAAAATCCACGGACAACGGCTGGAGTTGGCCGAGGTGGAGCGCGGCCTGCTCGAGATGCTCCCC
GAGGGATGCCATGCTCTCGCTACCGTCGTTCATCCTGCCGACGATTCATCGCCTGTTCTAGCCGGCTTCGTTTTG
TCCCCGGGGAATGTCGGCAGCGAAGGCCAAGTATTCGCTGATGCATCTCCTCAGTTCCGGCAGCTGGCCGAACGC
GTCATGACCGATCTCGCCGGCCGGCTGCCCCTATTCATGATCCCATCTGTGTTGATACCCCTGACGACCATCCCG
ACGAGCCGGAGCGGAAAGGGTGATAGGCGAGTCTTGGCCAGTCTGGCATCCGCTTACACCAGGAGGGAGCTGTAT
GCTTTCTGCAAGGACACTGCTGGCCAACTCCAGTCGCCGACGACCAAGAATGAAGAACTGCTTCACCAAGCCGTC
GAGCAGGTTCTTGGCGTCAACAACTTTAGCATGGGCGACAACTTCTTCAGCCTGGGCGGAGACTCGGTACGGGCC
ATGCTGCTGGCACGGCAGACGAGAGAGGCCGCGGGACTGGAAGTGACGGTAGAAAACATCCTCAAGAGCGCCACA
CTGTCAGAACTGGCATCGACCATGTGTCCCAGTCGAGAATCGGTCGATATCGCTCCCTTCTCGCTTCTCTCGGGC
CAGGACTCGGTAGAGGAGACGCTCAGCAGGGCCCGTTCGTGCTGCCGGCTGTCGAGCGTCGACGACGTCGAGGAC
ATTTATCCCTGCACAGCACTGCAGGAAGGCATCACAGCCTTATCCATGTCAAGCCACGAGGCCAAGTACGTCACA
TCATCGACCTATCGGCTGCCGCGGGCCGTCGACGTCCAACGGCTGAGGCGTGCGTGGGACTCGGTTGTAGCGAGC
AACCCGGTTCTGCGGACGCGGATCCTGCAGAGCGCCACCGGACAGGTGCTTCAGGCGGTGCTCAAGACGGCTGTC
GAGTGGGAGGTGGTCGCAGATCTCGCCGAGTTGGAGCGCCTGCAGCGGCAATGGCGAGTCGAGATCGGAGGTCCG
CTCCTCCGGCTGGCAATGGTCTCGACGAGCCGGGGCAACTATTTTTCCGTCTTCATCTCTCATGCCCTCTACGAC
GGCTGGTCGCTGCCCGAGACGCTGAAGCAGGTCGAAGCAGCCTATCACGGGGAGACGATATCGTCCAAGCCCTTC
AAACACTTCGTCAGCCATGTCCTGGCATCGGACGAGGCTCAGGCCCGCCAGTTCTGGCTCGAGAGCCTCAAGCAT
TACTCGGCTCAGCCCTTCCCCAGTGCTCCGGCCGGGCAGCTGCAGTATCGGCCGGCGGCTCTGCAGACGCTGAGA
CGCTCCGTGTCTATCCCGGACTCTCGCTCGCCGGAATGGACCCTTTCCACTGCCATCCTGCTCGCCTGGGCCGTG
ACCGTCTCTCAGTACACGGGCTCTGATGACGTTTGCTTCGGGACGACGCTCTCCGGGAGAAATACTGCCCTCTCA
GGGGTGGACCGTATCCTCGGTCCGACCATCACGACGATTCCATTGAGGACGCAGCTCGATCGGACACAGACGGTA
CAGAATGTCCTCTCCTCTTTGCATCGATGGCTCCAGGACTCGATTCCGCACCAGCATCTCGGCACCCAGCGTATA
GCGTCGCTTGGGACTGAAGCTGCGGCTGCTTCTCGGTTTCACAACCACCTCGTCATCCAGCCGCCTCCGTCGGAC
GAGACATCGACCATCTTCGCCGACGGGGATACCTGGGAAGTGGTGGATAACTATATGCTGGCACTGCAGGTTATC
CTCCCCAAGCCGGTGTCTGATGTCCTGTGTGTCGAGGTCAGCTACGATGACACGGCTGTTTCGCAATGGAAGATG
ACCAGGATCGCGGATCAGTTCTGTCACAATGTGCTCCAGATCCTATCCAACCCTTCCAAGACATTCCGTGATCTT
GACGATATGGACTTTGCAGGGCGGCGCATCATTATGGACTGGAACCGTCGGCTTCCCGATGTAGTCGACTGCTGC
GCCCACGACCTCATCAGTCGCCGGTGCCTCGGTCAAGCCGCAAGCCCTGCAGTCGATGCCTTTGATGGCAGCCTG
ACATATGGTCAGCTCGACGAACAGACGACCCAGCTCGCGGCACACCTTCAAGAAAAAGGGGCTGGTCCCGGGACT
TACGTCATGATCATGCTGGAGCGCTCCCTCTGGGCTGTCGTCGCCATCCTGGCCGTCATGAAGTCTGGAGCCGCA
TTCGTCGTCGTGGACTTGTCGACGCCGGATTCACGTCTGGAGCAGATTCGCGACGAGACGGAGCCGATACTGGCC
ATCACTTCGCCTCTGAACGTAGGGAGAGCAACGGAGCTGCATCTACCGGTCGTCATCGCCCATCATGGCTCGAGC
TGGCTGGCGGCTGGCGGAGAGCAGCAAATGTTCAAACCCCCGTCCGTATCGTCTCAAGACATTGTCTATGCCGTC
TTCACCTCCGGATCGACAGGCAGGCCCAAGGGCATCGCCGTTCCACACCGGGCGTTGGCCACGGGTGCCAGTATC
AGCGGACGGTCGCTTACGCTGGGACCTGGCAGTAGGGCCCTGCATGCGTCGTCGTACGCCTTTGACGCCTCCATC
GCGGAGATCATCTACACCTTGGTTCAGGGTGGGTGCGTCTGCGTTCCGTCCGAGGCGGACAGTCGGAACTGCCTC
GAAGACGCCATCGGCCGCTTCCACATCGACTGGGCCAGTCTGACGCCGTCTCTGACGAGGGCCCTGAACCCTGCC
AAGATGTCAACGATACGGACCTTGATCTGGGGTGGCGAGGCCGTCACCCGGGCCGACGTCGAGATGTGGCCTCAG
AGTATGCAGCTCATCAATGCCTACGGCCCGGCCGAGTGTACCATCGACAGCACCTTTCAGCACAACGTATCCCTG
AGCAGCCCTGCCAACATCGGCTACGGCTTCGCCACCGTGACCTGGATTGTCGACCCGGACGACCCGACGTGCGGT
AGCTTGGTGCCCCTGGGAGCCGTCGGGGAACTGGTGCTTGAAGGCCCTGTAGTGGCCGAGGGATACCTCAACAAT
CCCACCAAGACGGCCTCGTCCTTCGTCAACTATCCAGACTGGCTGAAGCAGCTCCGACGCGGGCAGCCTGGCCGG
CTATACCGGACGGGTGACTTGGTCCAGTACAGCCCATCTGGCGATGGATCACTTCTGTATCTGGGCCGCAAGGAC
AACCAGGTCAAGCTCCGTGGGCAGAGACTTGAGCTCGAGGAGGTGGAACAGCATCTGATGGACTGCCTGCCCGCA
GCCAAGGCCGTCGTCGCCGAGATCGTCAAGCCGTGCGATGCCGGTGCCGCTCCCGCCCTTGCTGCCTTCATCCTC
CTCGACGGTGTATCATCAGACGAGACGGGAGACGAGATACTCGCGTCAGGTGACTCGCCTCTATGCGCACAGCTC
GGTATCGCAGAGGCCCGCATGGCGTCCCGCGTGCCGAGGTTCATGGTTCCGGGCCTGTACCTCCCCCTGCTCCGG
CTGCCGACGTCGGTGGCCGGCAAGGCGAACCGGAGGTTGCTGCGAGAGATGGCCTCGGCTCTGACCAGGAAGCAA
CTCAAGGCGTACAGTTCGAGCGCGCTGCAGCCGCAGGCCCCGTCAACGGTGAAGGATAGAGCGCTGCACGAGGGC
GTGTGTGAGGTTCTCAAGCTGCCGCCGTTGGAAGTTGGCGTGAACAGCAACTTCTTCCAGCTGGGAGGCGACTCC
ATCACGGCCATGAAGCTGGCTGGACGGCTGCAGGACGCTGGGTTCTCCTTGTCTGTTGCCGATGTCTTCAAACAC
GGTACGCTGGAGAGCCTGGCTGCAACGCTGGAAGAGAATAGATTCGACCAAGACAGCTTTTCCAGGACGATTCCG
GCGTTTGCGCTGCTTCCCGAGGCACAACGTCGGGACACGATTCAGGCGGTTGCTCGAGAATGCGGAGTCTCCTTG
GACGATATTGAAGACGTCTACCCTTGCACGCCGATGCAGGAAGGCCTACTGTCCCTGACTATGAAGCAGCCAGGT
CAGTACGTGGCCGAGTTGATCTTTGACCTGCCGCCGGAGACGGACCTCGCCCGCGTCAGAACCGCATGGGATGCC
GTTTACGCCGCCAATGCCATCCTGCGAAGCCGCGTCGTGACGCTACGGTCTGGCTCAGGTTCGTCGTTGCAAGCC
GTCGTCAGGGAGCCTCTCTCCTGGAGCTCGACCCTCGACCCGCTCATTGTCGACCATGGGAAGCCGCTTCTAAAG
GTTGTGCTCAACGAACAAGATGGAAGACTGCATCTATGGTTGCACCACGCGCTGTACGATGGTGTCTCGTTGCCG
ATTCTCTTTGAGCAAGCCGAGGCGGCGTATCAGGGAGCTTCGTCGTTGCCAAGTTCGTCGTTCAACGCCTTTGCC
GCATACATGGAGAAGCTCGACGCGGCTGCGGGCCGACGTTTCTGGACCAAAGAGTTCCGAGATCTCGATACCGTT
CTGTTTCCGACCAGCACGAGATTACAACAGCCCTCTGCTTCGGCAGGCGAGCGGGAGTCTCTGTCGTGCAGCATC
TCCATTCCGGACATGAACGGGCTGGAGTTTACGCTCCCATCCGTTATCCACGCCGCCTGCGCCGCAACGCTCGGA
CACTTTGCTCACACGCGAGACGTCGTCTACGGGCTCACTCTGACGGGAAGAAATGCCCCCGTTGTGGGCATCGAC
GGCCTCGTCGGTCCAACCATCACGACAGTCCCTTTCCGGGTTCAACTGAGGCCGTCAATGACGGCGAGGGCCCTG
CTGTCGAGCATACAGGAGCACCTGGTGAGCATCATGCCTTACGAGCAGATGGGACTACAAGCGACGCGGTCCATC
AACTCCGAGTGCGCGACGGCGTGCGACTTCCAATGCTCCGTGGTGATTCAGCCGACCGACGATGAGACGGTGAAG
AAGAAGAGAATCTTTGGCGAGCCGCAAACCAGCAGCGACGAAGACTCGCTGTTCTCCAGCTCGCCGCTTGCCCTG
GAATTCACCGTCTCCAGCGATAGGCGCTCTGTTCATATGGTGGCCAACTTTGAAGTTTCGGTTCTAGATAGGGGC
GACGCGTCGAGTTTTGCCCGCCACCTCGAAAAGACGATTCAGCAGATCGTAAAGGACGCGGATTCGCAGGTGCAA
GACCTTCAAGAAGCCGGCCCGCATGACCTACAGCGCATCGAAAGCTGCAACGGATCATTCCGGCCTACAGTCGAC
AAGCTGGTGCAGGACCTGGTCAAGGAGCAATGCCGCTCAAGGCCCGGAGCCGAGGCCGTCTCCTCGTGGGACGGA
TCGTGGACGTACAGCGAGGTCGAAGACGCCAGTTCACGCCTGTCGAAACACCTGATGAGCCGAGGTGTCAGTACC
GGTCCCGTCACGGCCGTCTACATGGACAAGTCGCGGTGGATTGTTGTTGCCATTCTATCGGTCCTCAAGTCGGGC
TCGGCCTGCGTCCTGCTCGACAACGACTACTCGGAAGAGCAGATGAGAGACATGCTGAGGCAGACGGGTGCCGCT
TCGATTCTCACGTCTCCCGAGAAAGGCAGGATGGCGGAGAGTATCGCGGGCGGAAAAGGGGCTGCTGTCATCGTC
GTGTCTACAGCCTTGCTGCACAGCCCGCCACCGAGTCCGCCGCACTCACCCAAGACCATCCACAGCTCCGACGCC
GCTTTCGCCGTCTTCTCTTCGCCGGGGAGCGCAGGCAAGGTAGACGGCATGATGCTCGACCACGCTGCTGTGACG
ACGGGGCTGAGAGACCTATGCGGGCCGCATGGCTTGGACGAGACATCGAGGGTACTGCATTGCTCTTCTTTCGCC
TCTCGTGCAGGTCTGTTTGAGATTCTCGGTTGTCTAGCGGTTGGTGGTTGCCTGTGCATCCCGTCTGAGCAGGAC
TGCAACGTCTCTCGTCTCGGAGACTTTATCGAGAGCTACGGCGTCAACTGGGCGGGACTGATGTCGTCCGCCGCC
GGCAGCATTGAACCCAAGCTCGTTCCATCTCTCAAGACGCTGATGGTCAGGGGTGAAGTCGTCCGATCGGCAGAC
GTCAACCGCTGGGCGGCTGCTCGAGATGACGTCCGCCTCGTCAACTCGTACAGCCTGCGGGAGTGCCCCATGATC
TGCGCCGTCGGCCGCATACTTCCCGAGGAATGGACCCCGGGTCTCATCGGCCCCGTCGTCGGCGGCATCGGCTGG
GTTGTGAACCCGGATGACTACTCGAGGCTCTGTGCCGTCGGCGCCGTTGGAGAACTGATGATTGAGAGCCCCGTG
CGGTCTCGTCGGTGCGCCGGAGACGACTATCAGTTGGAATCGAGCTGTATCGCCAGCCCGGCTTGGCTGTCACGG
ATCCGTGGCCATGGCGGGAGCCGGCTGTATCGGACGGGCGACCTGGTGCAATACACGAGCCGGCTTGACATTCGC
TACCTGGGTCGAAGGGAGGCGGACGTGAAGCTCAGCGGCAGACGCGTACATTTGCAGGAGATGGAGAGTATTCTC
ATGAAACACATGCCGTCTGACGCTGTCGTCGTCGTCGATTTTGTCACGACCACCACTGGTCGTTGTCAGCTCTTC
GCCTTTATACAGCTCCCTCATCAGAAGCAGGCCACAGACAGCAAAGAAGGAAGCCTATTCTCCGAACCAGACCAA
GACTTTCTGAGCCTCTGTCGCGCCGCAAAACAGAGCCTCAGTGGGTTGTTATCGCGCGACATGATGCCCACCGCC
TTCATTCCCCTGACTCGGTTTCCCCGTACGACCAGCGGCAAGATCAACCGTCGCCTGCTTCGTGAAAAGGCCCGT
GATCTTCGGACGCCTGATCTCGACCTGGCCAAGCAGCCGATGAGCGAGGATGAGATTAACATGGCTCGGCTCTGG
GCCGATGTGCTCCAACTTCCCGCAGACGAGTTCTGCGCAACAGACAGTTTCTTCCACGTCGGCGGTGACTCCATC
GCAGCCATGAAGCTCGTTGCCGCGGCTCGAGAGCGAGGCCTGACCGTGACGGTGCCCGAGATCTTCTCTCATCCG
CACTTGGCTGACATGGCGTCGGTGGTCGAGAGTTCAAAACAGCAGCAGGCGTCGTCCCCTGACGTCGCGCCCTTT
TCTTTGCTGCCAGGAGACGAGAGAGAAGCGGTGCTGGAGGCGGCAGAGAGGTTGTGTCGCGTTCAGAGAGCAGAC
ATCGAAGACTGCTATCCGTGTACGCCGATGCAGGAGGCGCTCTTCTCGCAGTCGATGCGTTCCGACGGCGCTTTC
ACGGCCCATTTCCGATACAAGCTCGAGCCGGGCGTCGATGTGTCTCGATTCCAGACGGCGTGGGAGCGGGTCATG
GAGCGGAACCCGGTGCTTCGGACGCGAATTGTCTCGACGCGGGCCTTTTACCAGGTCGTGCTGACGCGGCCTGCT
GCGTGGGAGGTTGTCGACGAAGACGCACTGGAGGAGGCTGCCTCGGGGCTTTGCGGGAACGAGGTCCAGCTGGGA
TGCCCGCTGCTTCGTCTTCTGATATGCCCGCAGAGTATCGAGCCCGAGTTCTGTCTCGTCATTCATCATGCGCTG
TATGACGGCTGGTCGCTGGACCTTGTCTTGGATCAAGTGCAGCGGACTTACAAGGAGCAGCCTCTTCTCGTCTCT
CAGCCCTGGAATCACTTCATCCGTTACCTCGGCGAGCAGGATCAGGAGGCCGGACGCAAACACTGGCTCACTCAG
CTATCTGGCGCAACTGGAGCCGTCTTTCCAGCCTTGCCTGCACCCGACTTCAAGCCCTTTACCGACTGCATCATT
CGCCAGGAGGTCAAGCTTGAGGCTCTCCCGGATGTGACGCGCGCCGCTGTTCTCGAGTTCTGCTGGGCCGTTACC
GCGTCTCAGTATTGTAAAGCAACAGGTGTCTCCTATGGCCTCGTCCAGTCCGGCCGTGACGTCGGCGTACAGGGC
ATCGAATCCATGACTGGACCGACGATAGCGACTATTCCTGTTCATCTCACTCTCCACAAAGACGAGCCCGTCATC
CAAGCGCTGCGTCGTCTCCAAGGTCAGAGGGCGGCCGCCACGCCGTTCCAGCATTTCGGCTTGCAGAACATCCGC
CGGCTGAGCCGTCAGACCGAGGCGGCTTGCAGGTTCCAGAGCCTGCTGTTGATTCAGCACGCCGCAGCTGCTGCC
CCTGACGAAGAAGCCGAGAAGCTCTTTACGCTGGTGGCGGACGGCGACGATGAGGCTGGCAACTTTAGCGCTCAT
GCGCTGGAGGTTGTATGCGAGATGACGGACGACAGCAGCTGCGTGGTCGAGTTCCACTTTGACTCGAGCGTTCTT
GATCCGCGACAGGCGAGGCGAGTTCTGGGCCAGTATGTTTGGTTCGTCGAGCAGGTCCAGTCGAAGTCGACGCAC
GAACTCTCGCACCTGGACCTCGTCTCTCCCTCGGCGAAGCGGGAGATGATGGAGTGGAACTCGGTGCTCCCGAAA
GTTGTCGATGGCTGTGTTCACGACGGCATCCAATACCAGGTCGATGCCGAGGCAGTCTGTGCGTGGGACGGCAGC
TTCACTTATCGTCAGCTCGACGCCTTGTCTTCTGGCCTCTCGCTGCACCTCCGAAGCATCGGCGTCGGTCCCGAG
ACGTTCGTTCCCGTTCTGTGCGAGAAGAGCAAGTGGGTGTCGGTCGCCATTCTCGCTGTCGTCAGAGCTGGCGGC
GCCATCGTCTTTCTCGACGGAGACGATGATTTGCCACGGCTGAGATCCATCTGTGGAAGCGTCGATGCCGGGGTT
GTCTTGTCTTCCCAAGACTTTTCGACCATGGCTCGAGAAATAGCTTCGTCTGTCATCATCATCGAACAAGCTCCC
TGCGAGGCCAGCTCGACGAATCTTGTATCAACAGTTGCTTCTGACAACGCCTTGTACGCAGTCTTTGACTCGGAC
TCGCAACAGGGGGCTGTGGTGAGCCACGGAGCCTTCTTGACTGCCTTTTCGACACAAAAGCTTTCTCTTGATATC
GACGGCGATGCTCGGACGCTTCAATTCGCACCGCACGTGTCTCCGACGTGTATCGTCGACTACCTCTGGACCTTT
TTGACGGGCGGTTGCGTCTGTGTTGCTTCTGAAGATCGTCTGCGGCATGATGTTGCAGATGCCGTCTGCGAATTC
CGTGTCAGTCGAGCCGAGTTTACTCCATCCGTTGTGCGCACCCTTCGCCTCGACGATATGCCGACGTTGATGACC
GTCGTCCTGCGTCACGAGGCTCTATCGAAGCACGAGATGCATGCGTGGGCTGCCAAGGTTCGGCTTGTATACGCC
TACGGTTTGTCGGAGACTTCTGGGTACTGCTCTCTGACAGATGCCGACGTTGACTCGGATCCTTCGACTATCGGC
CGCGCGCAAAGCCTCCTTTCCTGGATTGTCGACAGGAATAAACACGATCTTCTCCTCCCCGTTGGCTCTGTTGGT
GAGCTGGTGCTCGAAGGACATGCCTTGGCTCGTGGCCATCTCGAGGCGCCAGAATTGTCGTCGTCGTCCTCCTTC
ATCGATATCACGCCTTCTTGGCTGCGAGGCTCGCGAACCGACACGAGGCTGTTGAGGACGGGCGTGTTGGCTCGG
TACAACCCGGATGGAAGCCTCTGCTACTGTGGTCGCAAGGACGCTCAGGTGCGGGTCAAGGACCAGCTGGTCAAT
CTCGAGGAGATTGAGCGCCAGGTTCGAGAGGTTGCTGTGTCGGTCCGTGACGTCGTTGCCGAGGCTGTGCTTTCG
ACGGACAAGGACGTCGGCCAGCTTCTTGCTGTCTTTGTTACGGGCTTGACGGATGTTGATGGCCAGGAGGCTGCT
TCGGGTTTCCTTTCCGCCAGTCAGAAGCATCGCGATGAGGCGCAGAGAGTGACGGAGCTGCTGAATGGTCGACTC
CCGAGCAACATGGTCCCAGACGTCATCATTCCTCTCGCCCGTCTTCCGGCTCGAACAAACGGCAAGACTCCTCGC
CAGTTGTTACGCGTCGAAGCAGCAGCCCTCACGAAGGAGCAAGTCGAGCAATACCAGCCAGGCCTCTCGGTCAAG
AGAGCGCCAGAGTCGGAGCTGCAGAAGACGCTTCAGGTGGTTGTTGCCGACGTCTTGGGCCTCGACCTCGAAGAC
TTTAGCATAGACGACAGCTTCTTCCGGCTTGGAGGCGACTCCATCATCGCCATTCGACTCGTCGAACGGGCCCGG
TCCAAGGGCTTCACGTTTCGCGTCTCTGACGTGTTCCAGAGCCCGAAGCTGTCTGATCTGTCCCGGTTCGTGGCC
AGTGGAGAGGAGAGCGCTGTGACGAACGGAACGACCAGCTCGTCGGAGCTAATTGGGAAGGTAGACAAGGGAGAG
TTGGTGATGGGATTGGCTGCCAAGGGGTTTCCGTGCACGGAGAATGACGTCGATGCGATTCTACCGGTTACGCAG
GCGGCTGAGCGCTATCTTCTCCAGACGCCGGAGTATTGGATCATCAACCTGCGAGGGGCGGTCGATGTTGAAGGG
CTGGAACGAGCGTGTTCCGACTTGGTTCTTCGACACGGGATCCTGCGGTCCGTCTTTGTATCGGATCAGGGCCGA
TTCCTGCAGCTCGTCTTGTCTCGGATGAAGACCATCGTCAGACACTTCCAGACGACGCTCGCCATTGCCGACTTT
GTCGAAGATCATCGCCGCAGGGACGTGATGAAGCTGCCGACGCTCGACATGCCGTTGACCGAGTTTCTGTTCGTG
CAGAGCAGCGCGAATGAGGAACCGCGAAAGGCTCTCGTTCTGCGGTTGAGCCACGCGCAGTTTGATGGCTACTGT
CTCCTGACGCTCTGGCAGGATCTCAAGCAGCTGTACGAAGGTGGCAGCCTTCCTCCCGCCGTGCCCTACTCTCTT
CACCTGCAGCAGTGGAAGCAGAGCCATACGGACGATGGCTTCGCTTTCTGGAGGGATACGCTGAAGGGCTCGTCG
ATTGCTCGCATTGATAATACCACCTTTGGTGATGAGGCCATCTCTCTTGAAGACTCCGAGTTCGTCACCACCTCT
CGACTCATCCATATCGGAGAATCTCTCCCTCGCAACACGACGGCGGCTACCATTGTCAAGGCTGCCTGGGCCGTG
GTTCTTGCCCGTCTCTCGGGTCACAACGACGGCGTCTTCGCGCAGGCGTCCAACGGACGAAGCTACGACTCGGCC
AAGGACGTGGTCGGCATGTGCCTCAACTTCATCCCCGTGCGATCGAGCGTCGACGCGGCGGCGACGGTGCCGGAG
CTGGTAGACGCCATGCAGCGGCAGCACCACCAGAGTCTCGCGCACGAGCTCATCGACTTTGACGAGATTGTGCGG
CGTTCGACGTCCTGGGCGGAGGGGAGCAGGCATCAGACGGTGCTGCTGCATCAGAACCTCGACCCGGATGAGGAG
TTTTGCCTGGGCGAGGCGGAGGCGTGGGTTACGTGCTGCTACGAGTGGCCTCATCCGCCGGACGAGATTCTGATT
GAGTCGTTTCCAAAGGGAGGGGGGAAGCTGCTGATGACGATGGATACGAGGAGTAATGTGCTGAGCAAGGGGAAT
GCGGATGCTGTTATGGATAGGCTGTGTCGTTTGATTGGGCTGGTTGCGCGGTTGGCGGGCGATTCGGGGGCGAGG
GTTGGGGGTTTGTTGGAGGCTGTTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail