Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1868
Gene name
LocationContig_183:172..2174
Strand+
Gene length (bp)2002
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01761 DHQ_synthase 3-dehydroquinate synthase 9.7E-52 85 333
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 9.5E-11 47 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZAE9|ACBC_ACTS5 2-epi-5-epi-valiolone synthase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbC PE=3 SV=3 9 389 2.0E-73
sp|P0CM22|ARO1_CRYNJ Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01990 PE=3 SV=1 15 338 2.0E-34
sp|P0CM23|ARO1_CRYNB Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB3730 PE=3 SV=1 15 338 2.0E-34
sp|P96749|AROB_CORP2 3-dehydroquinate synthase OS=Corynebacterium pseudotuberculosis (strain C231) GN=aroB PE=3 SV=2 104 381 3.0E-34
sp|B0K0I7|AROB_THEPX 3-dehydroquinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=aroB PE=3 SV=1 50 358 4.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZAE9|ACBC_ACTS5 2-epi-5-epi-valiolone synthase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbC PE=3 SV=3 9 389 2.0E-73
sp|P0CM22|ARO1_CRYNJ Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01990 PE=3 SV=1 15 338 2.0E-34
sp|P0CM23|ARO1_CRYNB Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB3730 PE=3 SV=1 15 338 2.0E-34
sp|P96749|AROB_CORP2 3-dehydroquinate synthase OS=Corynebacterium pseudotuberculosis (strain C231) GN=aroB PE=3 SV=2 104 381 3.0E-34
sp|B0K0I7|AROB_THEPX 3-dehydroquinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=aroB PE=3 SV=1 50 358 4.0E-34
sp|Q8RB14|AROB_CALS4 3-dehydroquinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aroB PE=3 SV=1 50 365 6.0E-34
sp|Q7VBT3|AROB_PROMA 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroB PE=3 SV=1 86 381 7.0E-34
sp|B0K924|AROB_THEP3 3-dehydroquinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=aroB PE=3 SV=1 50 350 9.0E-34
sp|B0JID6|AROB_MICAN 3-dehydroquinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroB PE=3 SV=1 50 380 1.0E-33
sp|A2BW03|AROB_PROM5 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroB PE=3 SV=1 50 376 2.0E-33
sp|Q6NH04|AROB_CORDI 3-dehydroquinate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=aroB PE=3 SV=1 87 354 4.0E-33
sp|Q9CCS4|AROB_MYCLE 3-dehydroquinate synthase OS=Mycobacterium leprae (strain TN) GN=aroB PE=3 SV=1 87 354 8.0E-33
sp|A8G451|AROB_PROM2 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroB PE=3 SV=1 50 358 1.0E-32
sp|Q4JVG2|AROB_CORJK 3-dehydroquinate synthase OS=Corynebacterium jeikeium (strain K411) GN=aroB PE=3 SV=1 81 379 2.0E-32
sp|A2BQG2|AROB_PROMS 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroB PE=3 SV=1 50 358 2.0E-32
sp|Q3AJM8|AROB_SYNSC 3-dehydroquinate synthase OS=Synechococcus sp. (strain CC9605) GN=aroB PE=3 SV=1 21 384 3.0E-32
sp|A4J3A3|AROB_DESRM 3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1 50 326 3.0E-32
sp|A4QEJ6|AROB_CORGB 3-dehydroquinate synthase OS=Corynebacterium glutamicum (strain R) GN=aroB PE=3 SV=1 87 381 6.0E-32
sp|A3PC83|AROB_PROM0 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroB PE=3 SV=1 50 358 7.0E-32
sp|Q96Y96|AROB_SULTO 3-dehydroquinate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aroB PE=3 SV=1 86 358 7.0E-32
sp|Q9X5D2|AROB_CORGL 3-dehydroquinate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroB PE=3 SV=2 87 381 8.0E-32
sp|Q31BK2|AROB_PROM9 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroB PE=3 SV=1 50 358 8.0E-32
sp|Q5HUF4|AROB_CAMJR 3-dehydroquinate synthase OS=Campylobacter jejuni (strain RM1221) GN=aroB PE=3 SV=1 86 384 2.0E-31
sp|Q9PNT2|AROB_CAMJE 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=aroB PE=3 SV=1 86 384 2.0E-31
sp|Q7U6M8|AROB_SYNPX 3-dehydroquinate synthase OS=Synechococcus sp. (strain WH8102) GN=aroB PE=3 SV=1 50 382 2.0E-31
sp|B1XKA0|AROB_SYNP2 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroB PE=3 SV=1 50 372 3.0E-31
sp|A6TL07|AROB_ALKMQ 3-dehydroquinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=aroB PE=3 SV=1 50 358 4.0E-31
sp|A1AQL5|AROB_PELPD 3-dehydroquinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=aroB PE=3 SV=1 49 374 4.0E-31
sp|A1R703|AROB_ARTAT 3-dehydroquinate synthase OS=Arthrobacter aurescens (strain TC1) GN=aroB PE=3 SV=1 62 330 5.0E-31
sp|A7H333|AROB_CAMJD 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=aroB PE=3 SV=1 86 384 8.0E-31
sp|A2C1E0|AROB_PROM1 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=aroB PE=3 SV=1 109 382 9.0E-31
sp|A5FRZ7|AROB_DEHMB 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroB PE=3 SV=1 50 384 1.0E-30
sp|A3LSZ2|ARO1_PICST Pentafunctional AROM polypeptide OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARO1 PE=3 SV=2 16 383 2.0E-30
sp|Q3ZZN1|AROB_DEHMC 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroB PE=3 SV=1 50 384 2.0E-30
sp|Q7V7S1|AROB_PROMM 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=aroB PE=3 SV=1 50 382 2.0E-30
sp|Q8FT31|AROB_COREF 3-dehydroquinate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aroB PE=3 SV=1 87 354 2.0E-30
sp|P9WPX9|AROB_MYCTU 3-dehydroquinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aroB PE=1 SV=1 87 354 2.0E-30
sp|P9WPX8|AROB_MYCTO 3-dehydroquinate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aroB PE=3 SV=1 87 354 2.0E-30
sp|P0A4Z5|AROB_MYCBO 3-dehydroquinate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aroB PE=3 SV=1 87 354 2.0E-30
sp|A1VZZ6|AROB_CAMJJ 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=aroB PE=3 SV=1 86 384 2.0E-30
sp|Q46LM0|AROB_PROMT 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=aroB PE=3 SV=1 109 382 3.0E-30
sp|A2C9Z1|AROB_PROM3 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=aroB PE=3 SV=1 50 382 3.0E-30
sp|Q74BL6|AROB_GEOSL 3-dehydroquinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=aroB PE=3 SV=1 50 335 3.0E-30
sp|A8FM57|AROB_CAMJ8 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=aroB PE=3 SV=1 86 384 4.0E-30
sp|Q9A434|AROB_CAUCR 3-dehydroquinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroB PE=3 SV=1 25 332 7.0E-30
sp|B8H332|AROB_CAUCN 3-dehydroquinate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=aroB PE=3 SV=1 25 332 7.0E-30
sp|B8H8V5|AROB_ARTCA 3-dehydroquinate synthase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=aroB PE=3 SV=1 62 330 7.0E-30
sp|C6HCG7|ARO1_AJECH Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain H143) GN=HCDG_03716 PE=3 SV=1 13 392 8.0E-30
sp|B8M0U4|ARO1_TALSN Pentafunctional AROM polypeptide OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=aroM PE=3 SV=1 54 392 9.0E-30
sp|Q5XNP0|ARO1_SCLSC Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum PE=3 SV=1 54 354 1.0E-29
sp|A7F7H0|ARO1_SCLS1 Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13550 PE=3 SV=1 54 354 1.0E-29
sp|B8I359|AROB_CLOCE 3-dehydroquinate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aroB PE=3 SV=1 45 358 1.0E-29
sp|C1F548|AROB_ACIC5 3-dehydroquinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=aroB PE=3 SV=1 23 380 1.0E-29
sp|Q3Z988|AROB_DEHM1 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroB PE=3 SV=1 50 384 2.0E-29
sp|A4TBX8|AROB_MYCGI 3-dehydroquinate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=aroB PE=3 SV=1 62 354 2.0E-29
sp|Q980I9|AROB_SULSO 3-dehydroquinate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aroB PE=3 SV=1 86 358 2.0E-29
sp|B6QWH9|ARO11_TALMQ Pentafunctional AROM polypeptide 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-1 PE=3 SV=1 54 392 2.0E-29
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 13 392 2.0E-29
sp|C0NL63|ARO1_AJECG Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_03893 PE=3 SV=1 13 392 3.0E-29
sp|Q7V209|AROB_PROMP 3-dehydroquinate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=aroB PE=3 SV=1 50 376 4.0E-29
sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 78 392 5.0E-29
sp|Q21H84|AROB_SACD2 3-dehydroquinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroB PE=3 SV=1 37 361 5.0E-29
sp|A6VDF9|AROB_PSEA7 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=aroB PE=3 SV=1 86 389 5.0E-29
sp|Q8DCM0|AROB_VIBVU 3-dehydroquinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroB PE=3 SV=1 47 386 6.0E-29
sp|B6QCA7|ARO12_TALMQ Pentafunctional AROM polypeptide 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-2 PE=3 SV=1 54 392 6.0E-29
sp|B6HAA7|ARO1_PENRW Pentafunctional AROM polypeptide OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aroM PE=3 SV=1 10 364 7.0E-29
sp|Q7MH84|AROB_VIBVY 3-dehydroquinate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroB PE=3 SV=1 50 386 7.0E-29
sp|C5JKE6|ARO1_AJEDS Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02999 PE=3 SV=1 13 392 8.0E-29
sp|A5UAU8|AROB_HAEIE 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroB PE=3 SV=1 86 373 8.0E-29
sp|A8QCB2|ARO1_MALGO Pentafunctional AROM polypeptide OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3989 PE=3 SV=1 22 303 9.0E-29
sp|C5G8R4|ARO1_AJEDR Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_01028 PE=3 SV=1 13 392 9.0E-29
sp|B7V3D1|AROB_PSEA8 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=aroB PE=3 SV=1 49 389 1.0E-28
sp|A5UG10|AROB_HAEIG 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroB PE=3 SV=1 86 373 1.0E-28
sp|A6VKZ5|AROB_ACTSZ 3-dehydroquinate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroB PE=3 SV=1 86 326 1.0E-28
sp|P43879|AROB_HAEIN 3-dehydroquinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroB PE=3 SV=1 86 373 1.0E-28
sp|P59487|AROB_BUCBP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroB PE=3 SV=1 30 359 1.0E-28
sp|Q38X86|AROB_LACSS 3-dehydroquinate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aroB PE=3 SV=1 43 330 1.0E-28
sp|Q0AJ12|AROB_NITEC 3-dehydroquinate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroB PE=3 SV=1 54 354 1.0E-28
sp|Q4JC76|AROB_SULAC 3-dehydroquinate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aroB PE=3 SV=1 86 358 1.0E-28
sp|Q0SV35|AROB_CLOPS 3-dehydroquinate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=aroB PE=3 SV=1 49 329 2.0E-28
sp|B0T8F3|AROB_CAUSK 3-dehydroquinate synthase OS=Caulobacter sp. (strain K31) GN=aroB PE=3 SV=1 25 386 2.0E-28
sp|Q02EX9|AROB_PSEAB 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aroB PE=3 SV=1 49 389 3.0E-28
sp|Q8XMJ3|AROB_CLOPE 3-dehydroquinate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=aroB PE=3 SV=1 49 329 3.0E-28
sp|Q6C1X5|ARO1_YARLI Pentafunctional AROM polypeptide OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARO1 PE=3 SV=1 54 391 3.0E-28
sp|C1FYJ9|ARO1_PARBD Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00875 PE=3 SV=2 13 392 4.0E-28
sp|B5ZA49|AROB_HELPG 3-dehydroquinate synthase OS=Helicobacter pylori (strain G27) GN=aroB PE=3 SV=1 86 334 4.0E-28
sp|A1T8F5|AROB_MYCVP 3-dehydroquinate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=aroB PE=3 SV=1 87 354 4.0E-28
sp|P07547|ARO1_EMENI Pentafunctional AROM polypeptide OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aromA PE=1 SV=3 10 332 4.0E-28
sp|B7K660|AROB_CYAP8 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroB PE=3 SV=1 50 380 4.0E-28
sp|B5E8I9|AROB_GEOBB 3-dehydroquinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=aroB PE=3 SV=1 49 353 4.0E-28
sp|C0S433|ARO1_PARBP Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02447 PE=3 SV=1 13 392 4.0E-28
sp|Q741J7|AROB_MYCPA 3-dehydroquinate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=aroB PE=3 SV=1 87 354 5.0E-28
sp|B7KJH2|AROB_CYAP7 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroB PE=3 SV=1 50 382 5.0E-28
sp|Q3M4V2|AROB_ANAVT 3-dehydroquinate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroB PE=3 SV=1 86 382 5.0E-28
sp|Q5N3D4|AROB_SYNP6 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroB PE=3 SV=1 25 381 6.0E-28
sp|Q0TTA0|AROB_CLOP1 3-dehydroquinate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=aroB PE=3 SV=1 49 329 6.0E-28
sp|Q9ZMF2|AROB_HELPJ 3-dehydroquinate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aroB PE=3 SV=1 86 330 6.0E-28
sp|C1H8L1|ARO1_PARBA Pentafunctional AROM polypeptide OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07102 PE=3 SV=2 13 392 9.0E-28
sp|B9KG40|AROB_CAMLR 3-dehydroquinate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=aroB PE=3 SV=1 78 381 1.0E-27
sp|B2USB4|AROB_HELPS 3-dehydroquinate synthase OS=Helicobacter pylori (strain Shi470) GN=aroB PE=3 SV=1 86 330 1.0E-27
sp|P34002|AROB_PSEAE 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aroB PE=3 SV=2 49 389 1.0E-27
sp|C1CEW4|AROB_STRZJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=aroB PE=3 SV=1 25 380 1.0E-27
sp|Q8XV62|AROB_RALSO 3-dehydroquinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroB PE=3 SV=1 86 309 2.0E-27
sp|C4Y9D5|ARO1_CLAL4 Pentafunctional AROM polypeptide OS=Clavispora lusitaniae (strain ATCC 42720) GN=ARO1 PE=3 SV=1 78 383 2.0E-27
sp|P56081|AROB_HELPY 3-dehydroquinate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aroB PE=1 SV=1 86 334 2.0E-27
sp|Q4QNY2|AROB_HAEI8 3-dehydroquinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroB PE=3 SV=1 86 373 2.0E-27
sp|Q0V3H0|ARO1_PHANO Pentafunctional AROM polypeptide OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_01444 PE=3 SV=2 78 332 2.0E-27
sp|P57924|AROB_PASMU 3-dehydroquinate synthase OS=Pasteurella multocida (strain Pm70) GN=aroB PE=3 SV=1 86 326 2.0E-27
sp|A5GF05|AROB_GEOUR 3-dehydroquinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=aroB PE=3 SV=1 75 354 2.0E-27
sp|B3H035|AROB_ACTP7 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroB PE=3 SV=1 86 381 2.0E-27
sp|A3MYR5|AROB_ACTP2 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroB PE=3 SV=1 86 381 2.0E-27
sp|B6J3I1|AROB_COXB2 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=aroB PE=3 SV=1 86 328 3.0E-27
sp|A1D244|ARO1_NEOFI Pentafunctional AROM polypeptide OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aroM PE=3 SV=1 13 364 3.0E-27
sp|A5H2Q8|ARO11_LODEL Pentafunctional AROM polypeptide 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-1 PE=3 SV=1 86 337 3.0E-27
sp|B0XRM8|ARO1_ASPFC Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aroM PE=3 SV=1 13 364 3.0E-27
sp|B6J4A4|AROB_COXB1 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=aroB PE=3 SV=1 86 328 3.0E-27
sp|Q83AJ2|AROB_COXBU 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroB PE=3 SV=1 86 328 3.0E-27
sp|A9NB81|AROB_COXBR 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aroB PE=3 SV=1 86 328 3.0E-27
sp|Q2YB61|AROB_NITMU 3-dehydroquinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroB PE=3 SV=1 50 326 3.0E-27
sp|Q4WS76|ARO1_ASPFU Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aroM PE=3 SV=1 13 364 3.0E-27
sp|Q5AME2|ARO1_CANAL Pentafunctional AROM polypeptide OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARO1 PE=3 SV=1 78 383 3.0E-27
sp|D1ZA70|ARO1_SORMK Pentafunctional AROM polypeptide OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_02366 PE=3 SV=1 54 332 3.0E-27
sp|A5H2P4|ARO12_LODEL Pentafunctional AROM polypeptide 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-2 PE=3 SV=1 86 337 4.0E-27
sp|Q2S2D3|AROB_SALRD 3-dehydroquinate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=aroB PE=3 SV=1 41 381 4.0E-27
sp|B6JKL2|AROB_HELP2 3-dehydroquinate synthase OS=Helicobacter pylori (strain P12) GN=aroB PE=3 SV=1 86 334 4.0E-27
sp|B3R7B8|AROB_CUPTR 3-dehydroquinate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroB PE=3 SV=1 86 328 4.0E-27
sp|B9WFG1|ARO1_CANDC Pentafunctional AROM polypeptide OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ARO1 PE=3 SV=1 78 383 4.0E-27
sp|Q8U0A8|AROB_PYRFU 3-dehydroquinate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aroB PE=3 SV=1 86 385 5.0E-27
sp|A1CP85|ARO1_ASPCL Pentafunctional AROM polypeptide OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aroM PE=3 SV=1 13 364 5.0E-27
sp|Q8DUW2|AROB_STRMU 3-dehydroquinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aroB PE=3 SV=1 22 382 5.0E-27
sp|Q46WJ4|AROB_CUPPJ 3-dehydroquinate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroB PE=3 SV=1 86 320 7.0E-27
sp|C6E0S2|AROB_GEOSM 3-dehydroquinate synthase OS=Geobacter sp. (strain M21) GN=aroB PE=3 SV=1 49 353 8.0E-27
sp|A8NMB4|ARO1_COPC7 Pentafunctional AROM polypeptide OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_09809 PE=3 SV=2 16 319 8.0E-27
sp|A6Q3Y3|AROB_NITSB 3-dehydroquinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroB PE=3 SV=1 86 326 9.0E-27
sp|Q9CES8|AROB_LACLA 3-dehydroquinate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=aroB PE=3 SV=1 25 382 9.0E-27
sp|B8ZKM4|AROB_STRPJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=aroB PE=3 SV=1 25 380 1.0E-26
sp|C7YZ74|ARO1_NECH7 Pentafunctional AROM polypeptide OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_47780 PE=3 SV=1 78 386 1.0E-26
sp|Q6AF95|AROB_LEIXX 3-dehydroquinate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=aroB PE=3 SV=1 87 354 1.0E-26
sp|C5M1X2|ARO1_CANTT Pentafunctional AROM polypeptide OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=ARO1 PE=3 SV=1 86 383 1.0E-26
sp|B4TY46|AROB_SALSV 3-dehydroquinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroB PE=3 SV=1 50 385 1.0E-26
sp|Q8X071|ARO1_NEUCR Pentafunctional AROM polypeptide OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-1 PE=3 SV=1 54 309 1.0E-26
sp|P73997|AROB_SYNY3 3-dehydroquinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroB PE=3 SV=1 50 380 1.0E-26
sp|Q827R8|AROB_STRAW 3-dehydroquinate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=aroB PE=3 SV=1 64 334 1.0E-26
sp|Q0D0F3|ARO1_ASPTN Pentafunctional AROM polypeptide OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aroM PE=3 SV=1 13 332 1.0E-26
sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 86 365 1.0E-26
sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 86 365 2.0E-26
sp|Q2UCP6|ARO1_ASPOR Pentafunctional AROM polypeptide OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aroM PE=3 SV=1 54 364 2.0E-26
sp|C9SE96|ARO1_VERA1 Pentafunctional AROM polypeptide OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03429 PE=3 SV=1 54 332 2.0E-26
sp|Q8VYV7|DHQS_ARATH 3-dehydroquinate synthase, chloroplastic OS=Arabidopsis thaliana GN=DHQS PE=1 SV=1 86 380 2.0E-26
sp|B7N1G6|AROB_ECO81 3-dehydroquinate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroB PE=3 SV=1 25 329 2.0E-26
sp|Q8YVQ0|AROB_NOSS1 3-dehydroquinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroB PE=3 SV=1 86 382 2.0E-26
sp|P77980|AROB_SALTY 3-dehydroquinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|Q8Z205|AROB_SALTI 3-dehydroquinate synthase OS=Salmonella typhi GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B8N4Q9|ARO1_ASPFN Pentafunctional AROM polypeptide OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aroM PE=3 SV=1 54 364 2.0E-26
sp|B0UTE6|AROB_HISS2 3-dehydroquinate synthase OS=Histophilus somni (strain 2336) GN=aroB PE=3 SV=1 86 326 2.0E-26
sp|A1SRB7|AROB_PSYIN 3-dehydroquinate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroB PE=3 SV=1 86 381 2.0E-26
sp|A7GYE1|AROB_CAMC5 3-dehydroquinate synthase OS=Campylobacter curvus (strain 525.92) GN=aroB PE=3 SV=1 86 384 2.0E-26
sp|Q82TB9|AROB_NITEU 3-dehydroquinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroB PE=3 SV=1 54 326 2.0E-26
sp|B5R7M8|AROB_SALG2 3-dehydroquinate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B5R2D5|AROB_SALEP 3-dehydroquinate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B5BH29|AROB_SALPK 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|C0Q0G1|AROB_SALPC 3-dehydroquinate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|A9MT55|AROB_SALPB 3-dehydroquinate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|Q5PLX2|AROB_SALPA 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B4SVI8|AROB_SALNS 3-dehydroquinate synthase OS=Salmonella newport (strain SL254) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B4TKR2|AROB_SALHS 3-dehydroquinate synthase OS=Salmonella heidelberg (strain SL476) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B5FJQ9|AROB_SALDC 3-dehydroquinate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|Q57IY8|AROB_SALCH 3-dehydroquinate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|B5F8K0|AROB_SALA4 3-dehydroquinate synthase OS=Salmonella agona (strain SL483) GN=aroB PE=3 SV=1 50 385 2.0E-26
sp|A9KBB1|AROB_COXBN 3-dehydroquinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aroB PE=3 SV=1 86 328 2.0E-26
sp|A8GKQ7|AROB_SERP5 3-dehydroquinate synthase OS=Serratia proteamaculans (strain 568) GN=aroB PE=3 SV=1 46 326 2.0E-26
sp|Q1CUM0|AROB_HELPH 3-dehydroquinate synthase OS=Helicobacter pylori (strain HPAG1) GN=aroB PE=3 SV=1 86 326 3.0E-26
sp|A6Q908|AROB_SULNB 3-dehydroquinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroB PE=3 SV=1 86 326 3.0E-26
sp|Q21BX8|AROB_RHOPB 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroB PE=3 SV=1 25 377 3.0E-26
sp|C1CL84|AROB_STRZP 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain P1031) GN=aroB PE=3 SV=1 25 380 3.0E-26
sp|C1C7X6|AROB_STRP7 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain 70585) GN=aroB PE=3 SV=1 25 380 3.0E-26
sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 86 390 3.0E-26
sp|Q48PH0|AROB_PSE14 3-dehydroquinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroB PE=3 SV=1 49 392 3.0E-26
sp|B0D6H2|ARO1_LACBS Pentafunctional AROM polypeptide OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_233717 PE=3 SV=1 16 332 3.0E-26
sp|B8GPV3|AROB_THISH 3-dehydroquinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=aroB PE=3 SV=1 50 329 4.0E-26
sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aro1 PE=3 SV=1 32 332 4.0E-26
sp|B7VLJ6|AROB_VIBTL 3-dehydroquinate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=aroB PE=3 SV=1 50 381 4.0E-26
sp|Q9V1H9|AROB_PYRAB 3-dehydroquinate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aroB PE=3 SV=2 86 326 4.0E-26
sp|Q30RT3|AROB_SULDN 3-dehydroquinate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=aroB PE=3 SV=1 86 359 5.0E-26
sp|B4F0B1|AROB_PROMH 3-dehydroquinate synthase OS=Proteus mirabilis (strain HI4320) GN=aroB PE=3 SV=1 25 332 5.0E-26
sp|B4RG33|AROB_PHEZH 3-dehydroquinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroB PE=3 SV=1 10 377 5.0E-26
sp|C1CQY0|AROB_STRZT 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=aroB PE=3 SV=1 25 380 5.0E-26
sp|Q8DPD1|AROB_STRR6 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=aroB PE=3 SV=1 25 380 5.0E-26
sp|Q04JX2|AROB_STRP2 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=aroB PE=3 SV=1 25 380 5.0E-26
sp|Q4P8F6|ARO1_USTMA Pentafunctional AROM polypeptide OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03607 PE=3 SV=1 73 341 5.0E-26
sp|Q97Q56|AROB_STRPN 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=aroB PE=3 SV=1 25 377 6.0E-26
sp|Q8J294|ARO1_THACU Pentafunctional AROM polypeptide OS=Thanatephorus cucumeris PE=3 SV=1 75 332 6.0E-26
sp|C5PA86|ARO1_COCP7 Pentafunctional AROM polypeptide OS=Coccidioides posadasii (strain C735) GN=CPC735_008210 PE=3 SV=1 13 332 6.0E-26
sp|B5YHI4|AROB_THEYD 3-dehydroquinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aroB PE=3 SV=1 62 382 6.0E-26
sp|Q47QY7|AROB_THEFY 3-dehydroquinate synthase OS=Thermobifida fusca (strain YX) GN=aroB PE=3 SV=1 86 330 6.0E-26
sp|Q9KXQ6|AROB_STRCO 3-dehydroquinate synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=aroB PE=3 SV=1 64 334 6.0E-26
sp|Q0I432|AROB_HAES1 3-dehydroquinate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroB PE=3 SV=1 86 326 7.0E-26
sp|C7GIN5|ARO1_YEAS2 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain JAY291) GN=ARO1 PE=3 SV=1 78 365 7.0E-26
sp|B5EP40|AROB_ACIF5 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroB PE=3 SV=1 25 326 7.0E-26
sp|B7J629|AROB_ACIF2 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroB PE=3 SV=1 25 326 7.0E-26
sp|A9BA66|AROB_PROM4 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=aroB PE=3 SV=1 45 382 7.0E-26
sp|Q0K669|AROB_CUPNH 3-dehydroquinate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroB PE=3 SV=1 86 326 8.0E-26
sp|Q3IJA2|AROB_PSEHT 3-dehydroquinate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroB PE=3 SV=1 86 382 8.0E-26
sp|Q60BY2|AROB_METCA 3-dehydroquinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroB PE=3 SV=1 35 385 8.0E-26
sp|A3CNV7|AROB_STRSV 3-dehydroquinate synthase OS=Streptococcus sanguinis (strain SK36) GN=aroB PE=3 SV=1 25 382 9.0E-26
sp|B3LGE9|ARO1_YEAS1 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARO1 PE=3 SV=1 78 365 1.0E-25
sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 78 365 1.0E-25
sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 78 365 1.0E-25
sp|B1YD64|AROB_PYRNV 3-dehydroquinate synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=aroB PE=3 SV=1 86 380 1.0E-25
sp|Q6F7E5|AROB_ACIAD 3-dehydroquinate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroB PE=3 SV=1 86 326 1.0E-25
sp|A6ZY89|ARO1_YEAS7 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain YJM789) GN=ARO1 PE=3 SV=1 78 365 1.0E-25
sp|B2IQJ3|AROB_STRPS 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=aroB PE=3 SV=1 25 377 1.0E-25
sp|B1ICH6|AROB_STRPI 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=aroB PE=3 SV=1 25 377 1.0E-25
sp|B3QAH7|AROB_RHOPT 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroB PE=3 SV=1 46 326 1.0E-25
sp|Q87V15|AROB_PSESM 3-dehydroquinate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroB PE=3 SV=1 49 392 1.0E-25
sp|A2RMH5|AROB_LACLM 3-dehydroquinate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=aroB PE=3 SV=1 25 382 1.0E-25
sp|Q6NCG9|AROB_RHOPA 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroB PE=3 SV=1 46 326 1.0E-25
sp|B5E5N3|AROB_STRP4 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=aroB PE=3 SV=1 25 377 1.0E-25
sp|Q7M8N9|AROB_WOLSU 3-dehydroquinate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=aroB PE=3 SV=1 35 381 2.0E-25
sp|Q8RU74|DHQS_SOLLC 3-dehydroquinate synthase, chloroplastic OS=Solanum lycopersicum GN=DHQS PE=2 SV=1 50 380 2.0E-25
sp|C3KAI3|AROB_PSEFS 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=aroB PE=3 SV=1 49 390 2.0E-25
sp|A5N6A8|AROB_CLOK5 3-dehydroquinate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=aroB PE=3 SV=1 25 343 2.0E-25
sp|B1WUD4|AROB_CYAA5 3-dehydroquinate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroB PE=3 SV=1 50 384 2.0E-25
sp|Q6A8I2|AROB_PROAC 3-dehydroquinate synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=aroB PE=3 SV=1 78 349 2.0E-25
sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 86 401 2.0E-25
sp|Q5X6H0|AROB_LEGPA 3-dehydroquinate synthase OS=Legionella pneumophila (strain Paris) GN=aroB PE=3 SV=1 86 326 2.0E-25
sp|Q5YTK6|AROB_NOCFA 3-dehydroquinate synthase OS=Nocardia farcinica (strain IFM 10152) GN=aroB PE=3 SV=1 105 354 2.0E-25
sp|Q5ZX00|AROB_LEGPH 3-dehydroquinate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aroB PE=3 SV=1 31 380 2.0E-25
sp|Q07VC9|AROB_RHOP5 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroB PE=3 SV=1 79 377 2.0E-25
sp|B8CNI9|AROB_SHEPW 3-dehydroquinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroB PE=3 SV=1 86 381 3.0E-25
sp|Q5P5P3|AROB_AROAE 3-dehydroquinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroB PE=3 SV=1 25 326 3.0E-25
sp|Q6MF52|AROB_PARUW 3-dehydroquinate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=aroB PE=3 SV=1 86 371 3.0E-25
sp|B2B223|ARO1_PODAN Pentafunctional AROM polypeptide OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_5280 PE=3 SV=1 54 309 3.0E-25
sp|C0ZZB6|AROB_RHOE4 3-dehydroquinate synthase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=aroB PE=3 SV=1 100 354 4.0E-25
sp|A6TF13|AROB_KLEP7 3-dehydroquinate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroB PE=3 SV=1 50 326 4.0E-25
sp|B9KSJ9|AROB_RHOSK 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroB PE=3 SV=1 7 382 4.0E-25
sp|A5D374|AROB_PELTS 3-dehydroquinate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=aroB PE=3 SV=1 50 326 4.0E-25
sp|Q3J2J0|AROB_RHOS4 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroB PE=3 SV=1 7 382 6.0E-25
sp|Q1LI88|AROB_CUPMC 3-dehydroquinate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroB PE=3 SV=1 86 309 6.0E-25
sp|B0CBS9|AROB_ACAM1 3-dehydroquinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroB PE=3 SV=1 86 381 6.0E-25
sp|P57604|AROB_BUCAI 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroB PE=3 SV=1 86 326 6.0E-25
sp|Q7NA56|AROB_PHOLL 3-dehydroquinate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroB PE=3 SV=1 86 326 6.0E-25
sp|U3KRF2|DHQS_ACTCH 3-dehydroquinate synthase, chloroplastic OS=Actinidia chinensis GN=DHQS PE=1 SV=2 50 382 6.0E-25
sp|A4RD09|ARO1_MAGO7 Pentafunctional AROM polypeptide OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01128 PE=3 SV=2 10 332 6.0E-25
sp|Q7VHT1|AROB_HELHP 3-dehydroquinate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=aroB PE=3 SV=1 86 326 6.0E-25
sp|A0JX82|AROB_ARTS2 3-dehydroquinate synthase OS=Arthrobacter sp. (strain FB24) GN=aroB PE=3 SV=1 122 330 7.0E-25
sp|A7MSY2|AROB_VIBCB 3-dehydroquinate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroB PE=3 SV=1 39 334 8.0E-25
sp|B2UEG9|AROB_RALPJ 3-dehydroquinate synthase OS=Ralstonia pickettii (strain 12J) GN=aroB PE=3 SV=1 25 309 8.0E-25
sp|A7ZD95|AROB_CAMC1 3-dehydroquinate synthase OS=Campylobacter concisus (strain 13826) GN=aroB PE=3 SV=1 86 384 9.0E-25
sp|Q39X04|AROB_GEOMG 3-dehydroquinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=aroB PE=3 SV=1 86 335 9.0E-25
sp|B1KP72|AROB_SHEWM 3-dehydroquinate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroB PE=3 SV=1 86 374 1.0E-24
sp|A5ETC5|AROB_BRASB 3-dehydroquinate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroB PE=3 SV=1 86 385 1.0E-24
sp|B2J913|AROB_NOSP7 3-dehydroquinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroB PE=3 SV=1 86 381 1.0E-24
sp|Q87L68|AROB_VIBPA 3-dehydroquinate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroB PE=3 SV=1 50 386 1.0E-24
sp|F2MTI0|AROB_ENTFO 3-dehydroquinate synthase OS=Enterococcus faecalis (strain ATCC 47077 / OG1RF) GN=aroB PE=3 SV=1 25 380 1.0E-24
sp|Q32AK1|AROB_SHIDS 3-dehydroquinate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroB PE=3 SV=1 25 329 1.0E-24
sp|A5IFX9|AROB_LEGPC 3-dehydroquinate synthase OS=Legionella pneumophila (strain Corby) GN=aroB PE=3 SV=1 86 326 1.0E-24
sp|B1JIQ4|AROB_YERPY 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|Q664M0|AROB_YERPS 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|A4TGU2|AROB_YERPP 3-dehydroquinate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|Q1CCP0|AROB_YERPN 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|A9R4A9|AROB_YERPG 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|Q8ZJF6|AROB_YERPE 3-dehydroquinate synthase OS=Yersinia pestis GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|B2K5T4|AROB_YERPB 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|Q1C2P3|AROB_YERPA 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|A7FNT5|AROB_YERP3 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroB PE=3 SV=1 46 326 1.0E-24
sp|A9ADP0|AROB_BURM1 3-dehydroquinate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroB PE=3 SV=1 62 317 2.0E-24
sp|Q2K3L3|AROB_RHIEC 3-dehydroquinate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroB PE=3 SV=1 25 382 2.0E-24
sp|Q39KC4|AROB_BURL3 3-dehydroquinate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroB PE=3 SV=1 54 317 2.0E-24
sp|C4LB07|AROB_TOLAT 3-dehydroquinate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroB PE=3 SV=1 50 381 2.0E-24
sp|B8HRK7|AROB_CYAP4 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroB PE=3 SV=1 86 360 2.0E-24
sp|A1RVE1|AROB_PYRIL 3-dehydroquinate synthase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=aroB PE=3 SV=1 86 380 2.0E-24
sp|B4E603|AROB_BURCJ 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroB PE=3 SV=1 54 317 2.0E-24
sp|Q65R35|AROB_MANSM 3-dehydroquinate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroB PE=3 SV=1 86 326 2.0E-24
sp|Q9KNV2|AROB_VIBCH 3-dehydroquinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroB PE=1 SV=2 86 381 2.0E-24
sp|C1B4I1|AROB_RHOOB 3-dehydroquinate synthase OS=Rhodococcus opacus (strain B4) GN=aroB PE=3 SV=1 105 322 2.0E-24
sp|Q7VNR5|AROB_HAEDU 3-dehydroquinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroB PE=3 SV=1 86 332 2.0E-24
sp|A3PJS2|AROB_RHOS1 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroB PE=3 SV=1 7 382 2.0E-24
sp|B1YRS4|AROB_BURA4 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroB PE=3 SV=1 54 317 3.0E-24
sp|A3DDJ2|AROB_CLOTH 3-dehydroquinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroB PE=3 SV=1 39 326 3.0E-24
sp|A4FBE8|AROB_SACEN 3-dehydroquinate synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=aroB PE=3 SV=1 87 354 3.0E-24
sp|Q02XB8|AROB_LACLS 3-dehydroquinate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=aroB PE=3 SV=1 25 382 3.0E-24
sp|A9MMD9|AROB_SALAR 3-dehydroquinate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroB PE=3 SV=1 50 385 3.0E-24
sp|Q4ZZE3|AROB_PSEU2 3-dehydroquinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroB PE=3 SV=1 49 326 3.0E-24
sp|Q0I052|AROB_SHESR 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-7) GN=aroB PE=3 SV=1 86 380 3.0E-24
sp|A3MUK4|AROB_PYRCJ 3-dehydroquinate synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=aroB PE=3 SV=1 86 326 3.0E-24
sp|B2I0J2|AROB_ACIBC 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroB PE=3 SV=1 40 380 3.0E-24
sp|Q5JFX1|AROB_THEKO 3-dehydroquinate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aroB PE=3 SV=1 86 340 4.0E-24
sp|Q8K939|AROB_BUCAP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroB PE=3 SV=1 31 326 4.0E-24
sp|A8AQU3|AROB_CITK8 3-dehydroquinate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroB PE=3 SV=1 50 326 4.0E-24
sp|Q2P6C9|AROB_XANOM 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=aroB PE=3 SV=1 84 321 5.0E-24
sp|Q92ME7|AROB_RHIME 3-dehydroquinate synthase OS=Rhizobium meliloti (strain 1021) GN=aroB PE=3 SV=1 25 385 5.0E-24
sp|B1JU67|AROB_BURCC 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroB PE=3 SV=1 54 317 5.0E-24
sp|B5YTT8|AROB_ECO5E 3-dehydroquinate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroB PE=3 SV=1 25 329 5.0E-24
sp|Q8X824|AROB_ECO57 3-dehydroquinate synthase OS=Escherichia coli O157:H7 GN=aroB PE=3 SV=1 25 329 5.0E-24
sp|A5EXS0|AROB_DICNV 3-dehydroquinate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroB PE=3 SV=1 86 392 5.0E-24
sp|A0K3S0|AROB_BURCH 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroB PE=3 SV=1 54 317 5.0E-24
sp|Q1BRZ3|AROB_BURCA 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroB PE=3 SV=1 54 317 5.0E-24
sp|Q2NQJ2|AROB_SODGM 3-dehydroquinate synthase OS=Sodalis glossinidius (strain morsitans) GN=aroB PE=3 SV=1 86 328 5.0E-24
sp|Q5QV59|AROB_IDILO 3-dehydroquinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroB PE=3 SV=1 86 382 5.0E-24
sp|B1ZQS6|AROB_OPITP 3-dehydroquinate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroB PE=3 SV=1 84 311 6.0E-24
sp|B3PPF1|AROB_RHIE6 3-dehydroquinate synthase OS=Rhizobium etli (strain CIAT 652) GN=aroB PE=3 SV=1 25 382 6.0E-24
sp|Q5NPY8|AROB_ZYMMO 3-dehydroquinate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=aroB PE=3 SV=1 50 381 6.0E-24
sp|A0RP96|AROB_CAMFF 3-dehydroquinate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=aroB PE=3 SV=1 86 384 6.0E-24
sp|Q1R5P8|AROB_ECOUT 3-dehydroquinate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B1LHI4|AROB_ECOSM 3-dehydroquinate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B7NDZ3|AROB_ECOLU 3-dehydroquinate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B1IP76|AROB_ECOLC 3-dehydroquinate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|Q8FCV7|AROB_ECOL6 3-dehydroquinate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|A1AGR6|AROB_ECOK1 3-dehydroquinate synthase OS=Escherichia coli O1:K1 / APEC GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B7NMF2|AROB_ECO7I 3-dehydroquinate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B7MD00|AROB_ECO45 3-dehydroquinate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B7UK94|AROB_ECO27 3-dehydroquinate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|Q8RF47|AROB_FUSNN Bifunctional 3-dehydroquinate synthase/phosphatase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=aroB PE=3 SV=1 30 322 6.0E-24
sp|Q5WXX5|AROB_LEGPL 3-dehydroquinate synthase OS=Legionella pneumophila (strain Lens) GN=aroB PE=3 SV=1 31 326 6.0E-24
sp|A9IZS4|AROB_BART1 3-dehydroquinate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=aroB PE=3 SV=1 50 305 6.0E-24
sp|A8A5J6|AROB_ECOHS 3-dehydroquinate synthase OS=Escherichia coli O9:H4 (strain HS) GN=aroB PE=3 SV=1 25 329 6.0E-24
sp|B0V8M9|AROB_ACIBY 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroB PE=3 SV=1 40 380 6.0E-24
sp|B7IAV6|AROB_ACIB5 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroB PE=3 SV=1 40 380 6.0E-24
sp|B7GVP5|AROB_ACIB3 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroB PE=3 SV=1 40 380 6.0E-24
sp|Q4KJI8|AROB_PSEF5 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aroB PE=3 SV=1 49 333 7.0E-24
sp|P0DH71|AROB_ENTFA 3-dehydroquinate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=aroB PE=3 SV=1 25 380 7.0E-24
sp|B5ZSI4|AROB_RHILW 3-dehydroquinate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroB PE=3 SV=1 25 382 7.0E-24
sp|B0VQ34|AROB_ACIBS 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroB PE=3 SV=1 40 380 7.0E-24
sp|Q8P6X3|AROB_XANCP 3-dehydroquinate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=aroB PE=3 SV=1 84 326 8.0E-24
sp|Q4UX86|AROB_XANC8 3-dehydroquinate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=aroB PE=3 SV=2 84 326 8.0E-24
sp|Q5H3H4|AROB_XANOR 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=aroB PE=3 SV=1 84 321 8.0E-24
sp|B2SKP5|AROB_XANOP 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=aroB PE=3 SV=1 84 321 8.0E-24
sp|C5D3E0|AROB_GEOSW 3-dehydroquinate synthase OS=Geobacillus sp. (strain WCH70) GN=aroB PE=3 SV=1 86 228 8.0E-24
sp|Q9Z6M3|AROB_CHLPN 3-dehydroquinate synthase OS=Chlamydia pneumoniae GN=aroB PE=3 SV=2 86 339 9.0E-24
sp|A4WFH7|AROB_ENT38 3-dehydroquinate synthase OS=Enterobacter sp. (strain 638) GN=aroB PE=3 SV=1 46 326 1.0E-23
sp|Q0BJ01|AROB_BURCM 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroB PE=3 SV=1 54 317 1.0E-23
sp|P07639|AROB_ECOLI 3-dehydroquinate synthase OS=Escherichia coli (strain K12) GN=aroB PE=1 SV=1 25 329 1.0E-23
sp|B1X736|AROB_ECODH 3-dehydroquinate synthase OS=Escherichia coli (strain K12 / DH10B) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|C4ZUP4|AROB_ECOBW 3-dehydroquinate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|Q3YWN4|AROB_SHISS 3-dehydroquinate synthase OS=Shigella sonnei (strain Ss046) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|Q31VP5|AROB_SHIBS 3-dehydroquinate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|B6I2U7|AROB_ECOSE 3-dehydroquinate synthase OS=Escherichia coli (strain SE11) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|B7M1U1|AROB_ECO8A 3-dehydroquinate synthase OS=Escherichia coli O8 (strain IAI1) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|B7L4R5|AROB_ECO55 3-dehydroquinate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|A7ZSR4|AROB_ECO24 3-dehydroquinate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|Q0TC78|AROB_ECOL5 3-dehydroquinate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|A4JAT5|AROB_BURVG 3-dehydroquinate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroB PE=3 SV=1 54 317 1.0E-23
sp|Q0SZS9|AROB_SHIF8 3-dehydroquinate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|Q63Q57|AROB_BURPS 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|A3NED2|AROB_BURP6 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|Q3JMW1|AROB_BURP1 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|A3P066|AROB_BURP0 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|A1V8D7|AROB_BURMS 3-dehydroquinate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|Q62GB0|AROB_BURMA 3-dehydroquinate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|A2S718|AROB_BURM9 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|A3MPY1|AROB_BURM7 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroB PE=3 SV=1 39 339 1.0E-23
sp|Q83PX0|AROB_SHIFL 3-dehydroquinate synthase OS=Shigella flexneri GN=aroB PE=3 SV=1 25 329 1.0E-23
sp|Q1IGA7|AROB_PSEE4 3-dehydroquinate synthase OS=Pseudomonas entomophila (strain L48) GN=aroB PE=3 SV=1 49 390 1.0E-23
sp|Q0HDV7|AROB_SHESM 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-4) GN=aroB PE=3 SV=1 86 382 1.0E-23
sp|Q6LVF5|AROB_PHOPR 3-dehydroquinate synthase OS=Photobacterium profundum GN=aroB PE=3 SV=1 41 377 1.0E-23
sp|C4JYG6|ARO1_UNCRE Pentafunctional AROM polypeptide OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07217 PE=3 SV=1 35 332 1.0E-23
sp|A8GZ30|AROB_SHEPA 3-dehydroquinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroB PE=3 SV=1 86 374 1.0E-23
sp|Q1MB46|AROB_RHIL3 3-dehydroquinate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aroB PE=3 SV=1 25 382 1.0E-23
sp|Q48S61|AROB_STRPM 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=aroB PE=3 SV=2 24 338 1.0E-23
sp|Q99YR3|AROB_STRP1 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M1 GN=aroB PE=3 SV=1 24 338 1.0E-23
sp|P0CZ81|AROB_STRPQ 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=aroB PE=3 SV=1 24 338 2.0E-23
sp|P0CZ80|AROB_STRP3 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=aroB PE=3 SV=1 24 338 2.0E-23
sp|B0TL76|AROB_SHEHH 3-dehydroquinate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroB PE=3 SV=1 86 302 2.0E-23
sp|Q3JEG3|AROB_NITOC 3-dehydroquinate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=aroB PE=3 SV=1 86 326 2.0E-23
sp|A7Z622|AROB_BACMF 3-dehydroquinate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=aroB PE=3 SV=1 25 207 2.0E-23
sp|Q5KXU5|AROB_GEOKA 3-dehydroquinate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=aroB PE=3 SV=1 50 223 2.0E-23
sp|Q83HU4|AROB_TROW8 3-dehydroquinate synthase OS=Tropheryma whipplei (strain TW08/27) GN=aroB PE=3 SV=1 109 321 2.0E-23
sp|C5BRJ7|AROB_TERTT 3-dehydroquinate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aroB PE=3 SV=1 86 326 2.0E-23
sp|A3M9I8|AROB_ACIBT 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroB PE=3 SV=2 40 380 2.0E-23
sp|C6DGD4|AROB_PECCP 3-dehydroquinate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroB PE=3 SV=1 46 329 2.0E-23
sp|A0L242|AROB_SHESA 3-dehydroquinate synthase OS=Shewanella sp. (strain ANA-3) GN=aroB PE=3 SV=1 86 382 2.0E-23
sp|Q89XW8|AROB_BRADU 3-dehydroquinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroB PE=3 SV=1 86 382 3.0E-23
sp|Q5XAW2|AROB_STRP6 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=aroB PE=3 SV=2 24 338 3.0E-23
sp|Q3BQS1|AROB_XANC5 3-dehydroquinate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=aroB PE=3 SV=1 84 321 3.0E-23
sp|Q87DU9|AROB_XYLFT 3-dehydroquinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroB PE=3 SV=1 62 326 3.0E-23
sp|B2I9G0|AROB_XYLF2 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M23) GN=aroB PE=3 SV=1 62 326 3.0E-23
sp|B1GZJ4|AROB_UNCTG 3-dehydroquinate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=aroB PE=3 SV=1 82 303 3.0E-23
sp|B2VJW7|AROB_ERWT9 3-dehydroquinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroB PE=3 SV=1 86 326 3.0E-23
sp|B7LS90|AROB_ESCF3 3-dehydroquinate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aroB PE=3 SV=1 50 329 3.0E-23
sp|A6LEZ7|AROB_PARD8 3-dehydroquinate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=aroB PE=3 SV=1 86 304 3.0E-23
sp|Q3B315|AROB_CHLL7 3-dehydroquinate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=aroB PE=3 SV=1 33 384 3.0E-23
sp|Q8U9V0|AROB_AGRFC 3-dehydroquinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aroB PE=3 SV=1 25 382 3.0E-23
sp|B5XME6|AROB_STRPZ 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=aroB PE=3 SV=1 24 338 4.0E-23
sp|A8G195|AROB_SHESH 3-dehydroquinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroB PE=3 SV=1 86 333 4.0E-23
sp|Q6CZQ9|AROB_PECAS 3-dehydroquinate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroB PE=3 SV=1 46 329 4.0E-23
sp|Q8DKS3|AROB_THEEB 3-dehydroquinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroB PE=3 SV=2 86 307 4.0E-23
sp|A4IQ88|AROB_GEOTN 3-dehydroquinate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=aroB PE=3 SV=1 50 326 4.0E-23
sp|Q3KJA1|AROB_PSEPF 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aroB PE=3 SV=1 49 333 4.0E-23
sp|A8AXZ4|AROB_STRGC 3-dehydroquinate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=aroB PE=3 SV=1 25 382 4.0E-23
sp|Q6L738|DOIS_STRKN 2-deoxy-scyllo-inosose synthase OS=Streptomyces kanamyceticus GN=kanC PE=1 SV=1 23 307 4.0E-23
sp|Q88CV2|AROB_PSEPK 3-dehydroquinate synthase OS=Pseudomonas putida (strain KT2440) GN=aroB PE=3 SV=1 49 390 4.0E-23
sp|Q83GD7|AROB_TROWT 3-dehydroquinate synthase OS=Tropheryma whipplei (strain Twist) GN=aroB PE=3 SV=1 109 321 5.0E-23
sp|A1AW10|AROB_RUTMC 3-dehydroquinate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aroB PE=3 SV=1 86 310 5.0E-23
sp|A0Q706|AROB_FRATN 3-dehydroquinate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroB PE=3 SV=1 86 329 5.0E-23
sp|A4WSQ8|AROB_RHOS5 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroB PE=3 SV=1 86 382 5.0E-23
sp|A6UCL4|AROB_SINMW 3-dehydroquinate synthase OS=Sinorhizobium medicae (strain WSM419) GN=aroB PE=3 SV=1 25 382 5.0E-23
sp|B6JVD0|ARO1_SCHJY Pentafunctional AROM polypeptide OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=aro1 PE=3 SV=1 86 309 5.0E-23
sp|B2U3J5|AROB_SHIB3 3-dehydroquinate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroB PE=3 SV=1 25 329 5.0E-23
sp|Q88XU0|AROB_LACPL 3-dehydroquinate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=aroB PE=3 SV=2 24 308 6.0E-23
sp|A2RDH0|AROB_STRPG 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=aroB PE=3 SV=1 24 338 6.0E-23
sp|Q1Q8Q9|AROB_PSYCK 3-dehydroquinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroB PE=3 SV=1 86 370 6.0E-23
sp|Q8PI87|AROB_XANAC 3-dehydroquinate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=aroB PE=3 SV=1 84 321 6.0E-23
sp|B5YE18|AROB_DICT6 3-dehydroquinate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=aroB PE=3 SV=1 85 320 7.0E-23
sp|B5XTU7|AROB_KLEP3 3-dehydroquinate synthase OS=Klebsiella pneumoniae (strain 342) GN=aroB PE=3 SV=1 50 326 7.0E-23
sp|Q9JVW5|AROB_NEIMA 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroB PE=3 SV=1 86 302 7.0E-23
sp|B4RQ17|AROB_NEIG2 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroB PE=3 SV=1 86 302 7.0E-23
sp|Q5FAD4|AROB_NEIG1 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroB PE=3 SV=1 86 302 7.0E-23
sp|B0U6C7|AROB_XYLFM 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M12) GN=aroB PE=3 SV=1 62 340 8.0E-23
sp|Q31DP9|AROB_THICR 3-dehydroquinate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroB PE=3 SV=1 37 317 8.0E-23
sp|A9M1U4|AROB_NEIM0 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aroB PE=3 SV=1 86 302 8.0E-23
sp|Q2MF70|DOIS_STRLV 2-deoxy-scyllo-inosose synthase OS=Streptomyces lividus GN=livC PE=3 SV=1 46 326 9.0E-23
sp|A1WZA9|AROB_HALHL 3-dehydroquinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=aroB PE=3 SV=1 86 221 1.0E-22
sp|Q01Q15|AROB_SOLUE 3-dehydroquinate synthase OS=Solibacter usitatus (strain Ellin6076) GN=aroB PE=3 SV=1 86 325 1.0E-22
sp|Q2A418|AROB_FRATH 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroB PE=3 SV=1 86 329 1.0E-22
sp|A7NBH0|AROB_FRATF 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroB PE=3 SV=1 86 329 1.0E-22
sp|A5WAB1|AROB_PSEP1 3-dehydroquinate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aroB PE=3 SV=1 49 390 1.0E-22
sp|P63618|AROB_STAAN 3-dehydroquinate synthase OS=Staphylococcus aureus (strain N315) GN=aroB PE=3 SV=1 80 329 1.0E-22
sp|P63617|AROB_STAAM 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aroB PE=3 SV=1 80 329 1.0E-22
sp|A5ISZ5|AROB_STAA9 3-dehydroquinate synthase OS=Staphylococcus aureus (strain JH9) GN=aroB PE=3 SV=1 80 329 1.0E-22
sp|A6U1T4|AROB_STAA2 3-dehydroquinate synthase OS=Staphylococcus aureus (strain JH1) GN=aroB PE=3 SV=1 80 329 1.0E-22
sp|A7X2G6|AROB_STAA1 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=aroB PE=3 SV=1 80 329 1.0E-22
sp|B2SGC9|AROB_FRATM 3-dehydroquinate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroB PE=3 SV=1 86 329 2.0E-22
sp|A4VVS9|AROB_STRSY 3-dehydroquinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=aroB PE=3 SV=1 25 381 2.0E-22
sp|A4W236|AROB_STRS2 3-dehydroquinate synthase OS=Streptococcus suis (strain 98HAH33) GN=aroB PE=3 SV=1 25 381 2.0E-22
sp|Q8KCK9|AROB_CHLTE 3-dehydroquinate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=aroB PE=3 SV=1 50 323 2.0E-22
sp|B3DUF9|AROB_METI4 3-dehydroquinate synthase OS=Methylacidiphilum infernorum (isolate V4) GN=aroB PE=3 SV=1 86 322 2.0E-22
sp|Q98FY1|AROB_RHILO 3-dehydroquinate synthase OS=Rhizobium loti (strain MAFF303099) GN=aroB PE=3 SV=1 50 313 2.0E-22
sp|A4VH14|AROB_PSEU5 3-dehydroquinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=aroB PE=3 SV=1 49 326 2.0E-22
sp|Q8P036|AROB_STRP8 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=aroB PE=3 SV=1 24 338 2.0E-22
sp|Q5M556|AROB_STRT2 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=aroB PE=3 SV=1 54 382 2.0E-22
sp|Q5M0M0|AROB_STRT1 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=aroB PE=3 SV=1 54 382 2.0E-22
sp|Q5NFS1|AROB_FRATT 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroB PE=3 SV=1 86 329 2.0E-22
sp|Q14H73|AROB_FRAT1 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroB PE=3 SV=1 86 329 2.0E-22
sp|Q4FQI3|AROB_PSYA2 3-dehydroquinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroB PE=3 SV=1 86 383 2.0E-22
sp|B9JBT6|AROB_AGRRK 3-dehydroquinate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=aroB PE=3 SV=1 25 382 2.0E-22
sp|Q9PDP5|AROB_XYLFA 3-dehydroquinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroB PE=3 SV=1 86 326 2.0E-22
sp|Q15Y44|AROB_PSEA6 3-dehydroquinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroB PE=3 SV=1 39 321 3.0E-22
sp|O50468|AROB_NEIGO 3-dehydroquinate synthase OS=Neisseria gonorrhoeae GN=aroB PE=3 SV=1 86 302 3.0E-22
sp|C1D4Z4|AROB_LARHH 3-dehydroquinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroB PE=3 SV=1 25 385 3.0E-22
sp|Q8EK19|AROB_SHEON 3-dehydroquinate synthase OS=Shewanella oneidensis (strain MR-1) GN=aroB PE=3 SV=1 50 337 4.0E-22
sp|Q2RMW0|AROB_RHORT 3-dehydroquinate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroB PE=3 SV=1 24 329 4.0E-22
sp|A8FEK4|AROB_BACP2 3-dehydroquinate synthase OS=Bacillus pumilus (strain SAFR-032) GN=aroB PE=3 SV=1 25 201 4.0E-22
sp|Q03LH4|AROB_STRTD 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=aroB PE=3 SV=1 54 382 4.0E-22
sp|C4K6Q9|AROB_HAMD5 3-dehydroquinate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroB PE=3 SV=1 86 329 4.0E-22
sp|A1KS84|AROB_NEIMF 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroB PE=3 SV=1 86 311 6.0E-22
sp|Q9JY01|AROB_NEIMB 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroB PE=3 SV=1 86 311 6.0E-22
sp|Q6GGU4|AROB_STAAR 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MRSA252) GN=aroB PE=1 SV=1 80 305 6.0E-22
sp|Q4FNG5|AROB_PELUB 3-dehydroquinate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=aroB PE=3 SV=1 24 311 8.0E-22
sp|A7I291|AROB_CAMHC 3-dehydroquinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=aroB PE=3 SV=1 86 310 9.0E-22
sp|Q9PK25|AROB_CHLMU 3-dehydroquinate synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=aroB PE=3 SV=1 86 313 1.0E-21
sp|B0BC03|AROB_CHLTB 3-dehydroquinate synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=aroB PE=3 SV=1 86 312 1.0E-21
sp|B0B7T8|AROB_CHLT2 3-dehydroquinate synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=aroB PE=3 SV=1 86 312 1.0E-21
sp|O84374|AROB_CHLTR 3-dehydroquinate synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=aroB PE=3 SV=1 86 312 1.0E-21
sp|Q3KLY7|AROB_CHLTA 3-dehydroquinate synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=aroB PE=3 SV=1 86 312 1.0E-21
sp|Q8NWN4|AROB_STAAW 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MW2) GN=aroB PE=3 SV=1 80 305 1.0E-21
sp|Q6G997|AROB_STAAS 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MSSA476) GN=aroB PE=3 SV=1 80 305 1.0E-21
sp|Q7NZU4|AROB_CHRVO 3-dehydroquinate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aroB PE=3 SV=1 62 302 2.0E-21
sp|Q5L5F1|AROB_CHLAB 3-dehydroquinate synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=aroB PE=3 SV=1 86 312 2.0E-21
sp|Q2YY89|AROB_STAAB 3-dehydroquinate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aroB PE=3 SV=1 80 305 2.0E-21
sp|B1J2J5|AROB_PSEPW 3-dehydroquinate synthase OS=Pseudomonas putida (strain W619) GN=aroB PE=3 SV=1 49 390 2.0E-21
sp|Q2FYH0|AROB_STAA8 3-dehydroquinate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=aroB PE=3 SV=1 80 305 2.0E-21
sp|A7MKL4|AROB_CROS8 3-dehydroquinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroB PE=3 SV=1 46 326 2.0E-21
sp|Q088S6|AROB_SHEFN 3-dehydroquinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroB PE=3 SV=1 86 322 2.0E-21
sp|Q9S5E2|DOIS_BACCI 2-deoxy-scyllo-inosose synthase OS=Bacillus circulans GN=btrC PE=1 SV=1 86 314 2.0E-21
sp|P31102|AROB_BACSU 3-dehydroquinate synthase OS=Bacillus subtilis (strain 168) GN=aroB PE=3 SV=1 31 201 2.0E-21
sp|C1DHQ5|AROB_AZOVD 3-dehydroquinate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=aroB PE=3 SV=1 49 326 2.0E-21
sp|Q8E4F3|AROB_STRA3 3-dehydroquinate synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=aroB PE=3 SV=1 25 382 2.0E-21
sp|Q3K0D4|AROB_STRA1 3-dehydroquinate synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=aroB PE=3 SV=1 25 382 2.0E-21
sp|A4IYI9|AROB_FRATW 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroB PE=3 SV=1 86 329 2.0E-21
sp|Q8EXX1|AROB_LEPIN 3-dehydroquinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=aroB PE=3 SV=1 54 303 2.0E-21
sp|Q75FW3|AROB_LEPIC 3-dehydroquinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=aroB PE=3 SV=1 54 303 2.0E-21
sp|A8Z445|AROB_STAAT 3-dehydroquinate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=aroB PE=3 SV=1 80 305 3.0E-21
sp|A6QH16|AROB_STAAE 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Newman) GN=aroB PE=3 SV=1 80 305 3.0E-21
sp|Q5HFV8|AROB_STAAC 3-dehydroquinate synthase OS=Staphylococcus aureus (strain COL) GN=aroB PE=3 SV=1 80 305 3.0E-21
sp|Q2FGX5|AROB_STAA3 3-dehydroquinate synthase OS=Staphylococcus aureus (strain USA300) GN=aroB PE=3 SV=1 80 305 3.0E-21
sp|Q6G1H4|AROB_BARQU 3-dehydroquinate synthase OS=Bartonella quintana (strain Toulouse) GN=aroB PE=3 SV=1 50 382 3.0E-21
sp|Q7VRN3|AROB_BLOFL 3-dehydroquinate synthase OS=Blochmannia floridanus GN=aroB PE=3 SV=1 67 328 4.0E-21
sp|A5CX62|AROB_VESOH 3-dehydroquinate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=aroB PE=3 SV=1 86 382 4.0E-21
sp|Q0BMF4|AROB_FRATO 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroB PE=3 SV=1 86 329 4.0E-21
sp|Q8DYU5|AROB_STRA5 3-dehydroquinate synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=aroB PE=3 SV=1 25 382 4.0E-21
sp|A6WTR1|AROB_SHEB8 3-dehydroquinate synthase OS=Shewanella baltica (strain OS185) GN=aroB PE=3 SV=1 86 385 4.0E-21
sp|A9L694|AROB_SHEB9 3-dehydroquinate synthase OS=Shewanella baltica (strain OS195) GN=aroB PE=3 SV=1 86 385 4.0E-21
sp|Q255H6|AROB_CHLFF 3-dehydroquinate synthase OS=Chlamydophila felis (strain Fe/C-56) GN=aroB PE=3 SV=1 86 313 4.0E-21
sp|Q12659|ARO1_PNECA Pentafunctional AROM polypeptide OS=Pneumocystis carinii GN=arom PE=3 SV=1 54 338 4.0E-21
sp|B8E259|AROB_DICTD 3-dehydroquinate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=aroB PE=3 SV=1 85 382 5.0E-21
sp|Q8G5X4|AROKB_BIFLO Bifunctional shikimate kinase/3-dehydroquinate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=aroB PE=3 SV=1 87 309 5.0E-21
sp|A3DA14|AROB_SHEB5 3-dehydroquinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroB PE=3 SV=1 86 385 5.0E-21
sp|Q6FIV4|ARO1_CANGA Pentafunctional AROM polypeptide OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARO1 PE=3 SV=1 86 365 5.0E-21
sp|A1B1J4|AROB_PARDP 3-dehydroquinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroB PE=3 SV=1 25 384 5.0E-21
sp|Q47JK6|AROB_DECAR 3-dehydroquinate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroB PE=3 SV=1 50 381 5.0E-21
sp|Q5LSX9|AROB_RUEPO 3-dehydroquinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aroB PE=3 SV=1 25 382 5.0E-21
sp|C5BGQ4|AROB_EDWI9 3-dehydroquinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroB PE=3 SV=1 86 326 6.0E-21
sp|Q8ZW80|AROB_PYRAE 3-dehydroquinate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aroB PE=3 SV=1 86 309 6.0E-21
sp|Q2MFP1|DOIS_STRRY 2-deoxy-scyllo-inosose synthase OS=Streptomyces rimosus subsp. paromomycinus GN=parC PE=3 SV=1 46 326 6.0E-21
sp|Q489N3|AROB_COLP3 3-dehydroquinate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroB PE=3 SV=1 41 322 6.0E-21
sp|Q28PF8|AROB_JANSC 3-dehydroquinate synthase OS=Jannaschia sp. (strain CCS1) GN=aroB PE=3 SV=1 25 333 6.0E-21
sp|A4XPQ2|AROB_PSEMY 3-dehydroquinate synthase OS=Pseudomonas mendocina (strain ymp) GN=aroB PE=3 SV=1 49 351 7.0E-21
sp|A6W2T3|AROB_MARMS 3-dehydroquinate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroB PE=3 SV=1 86 385 7.0E-21
sp|B8EBF1|AROB_SHEB2 3-dehydroquinate synthase OS=Shewanella baltica (strain OS223) GN=aroB PE=3 SV=1 86 385 7.0E-21
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup796
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7895
Ophiocordyceps australis map64 (Brazil) OphauB2|6404
Ophiocordyceps camponoti-floridani Ophcf2|01975
Ophiocordyceps camponoti-rufipedis Ophun1|1868 (this protein)
Ophiocordyceps kimflemingae Ophio5|4754
Ophiocordyceps subramaniannii Hirsu2|3310
Ophiocordyceps subramaniannii Hirsu2|3312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1868
MSDLKATVDSTATGFSVRGYERIEYDFHFLDGVFHPANTQLADCYRAWGRCLAVMDLNMHTLYGDQMRRYFDTHS
IALVVHKTAIGEKAKSIETLLSIVDSMDAFGVIRKEPVLVVGGGLVTDVAGFACAAYRRNTNYIRIPTTVIGLID
AAVSIKVAVNYGRCKNRLGAYHAPLHTFLDFTFLRTLPKAQIRNGFAELIKISSCADADTFDLLDRHCELLIDTA
FARADGSCPELRRAADRICRAGIYEMLRLETPNLHELMLDRVIAYGHTWSPIFELVPDPPLRHGHAISIDMAYSA
TLAHSRGLLTGPDHQRLLRLFSRSGLAMDHADFDATILERATAAILKTRDGLLRAPVPVSPLGRCLFLNDVSHQE
MRAALEEHKRIVADFPRRGEGIDAFVDASDTGYTTVQGPEINHAVVATVDKAGRAAPEVSVAALQTNGVA*
Coding >Ophun1|1868
ATGTCGGACCTCAAGGCCACCGTCGACAGCACCGCCACCGGCTTCTCCGTCCGCGGCTACGAACGCATCGAGTAC
GACTTTCACTTCCTCGATGGCGTCTTCCATCCTGCCAACACGCAGCTGGCCGACTGCTACCGCGCCTGGGGCCGG
TGCCTGGCCGTCATGGACCTCAACATGCACACGCTGTACGGGGACCAGATGAGGCGCTACTTTGACACCCATTCC
ATTGCCCTCGTCGTCCACAAGACGGCCATTGGTGAAAAGGCAAAGAGCATCGAGACGCTGCTGAGCATCGTCGAC
TCGATGGATGCCTTTGGCGTCATCCGCAAGGAGCCTGTTCTTGTTGTTGGCGGCGGCCTGGTGACTGATGTGGCA
GGCTTCGCCTGCGCCGCCTACCGCCGCAACACAAACTACATCCGCATCCCAACCACAGTAATCGGCCTCATCGAC
GCCGCCGTCTCCATCAAAGTAGCCGTCAACTACGGCCGCTGCAAGAACCGACTAGGCGCCTACCACGCCCCTCTT
CACACCTTTCTCGACTTCACCTTCCTACGCACCCTGCCCAAAGCCCAGATCCGAAACGGCTTCGCAGAGCTCATC
AAGATCTCGTCCTGTGCCGATGCCGATACCTTTGATCTTCTTGATCGCCACTGCGAGCTCCTCATCGATACCGCC
TTTGCCCGTGCCGATGGCTCGTGTCCTGAGCTTAGACGGGCGGCTGATCGTATCTGTCGCGCTGGTATCTATGAG
ATGTTGAGGCTTGAGACGCCCAACCTCCACGAGCTGATGCTCGACCGCGTCATCGCCTACGGCCACACCTGGTCC
CCCATCTTCGAACTGGTCCCAGACCCTCCCCTTCGCCACGGCCACGCCATCTCCATCGACATGGCCTACTCAGCA
ACCCTAGCTCACAGCCGAGGCCTCCTCACGGGCCCAGACCATCAGCGTCTCCTCCGTCTCTTCTCTCGCTCAGGC
CTGGCCATGGATCACGCCGACTTCGACGCCACCATCCTCGAGCGAGCCACGGCCGCCATCCTCAAGACGCGCGAT
GGCCTCCTCCGAGCTCCCGTCCCAGTCTCGCCCCTCGGCCGCTGCCTCTTCCTCAACGACGTCTCGCACCAAGAG
ATGCGTGCCGCCCTCGAAGAGCACAAACGCATCGTCGCCGACTTTCCTCGACGAGGCGAGGGCATCGATGCCTTT
GTCGACGCCAGCGATACCGGATACACCACCGTCCAGGGGCCCGAAATCAATCATGCCGTCGTTGCCACTGTTGAC
AAGGCCGGCCGTGCCGCTCCCGAGGTCTCCGTTGCCGCCCTGCAGACAAATGGCGTGGCCTGA
Transcript >Ophun1|1868
ATGTCGGACCTCAAGGCCACCGTCGACAGCACCGCCACCGGCTTCTCCGTCCGCGGCTACGAACGCATCGAGTAC
GACTTTCACTTCCTCGATGGCGTCTTCCATCCTGCCAACACGCAGCTGGCCGACTGCTACCGCGCCTGGGGCCGG
TGCCTGGCCGTCATGGACCTCAACATGCACACGCTGTACGGGGACCAGATGAGGCGCTACTTTGACACCCATTCC
ATTGCCCTCGTCGTCCACAAGACGGCCATTGGTGAAAAGGCAAAGAGCATCGAGACGCTGCTGAGCATCGTCGAC
TCGATGGATGCCTTTGGCGTCATCCGCAAGGAGCCTGTTCTTGTTGTTGGCGGCGGCCTGGTGACTGATGTGGCA
GGCTTCGCCTGCGCCGCCTACCGCCGCAACACAAACTACATCCGCATCCCAACCACAGTAATCGGCCTCATCGAC
GCCGCCGTCTCCATCAAAGTAGCCGTCAACTACGGCCGCTGCAAGAACCGACTAGGCGCCTACCACGCCCCTCTT
CACACCTTTCTCGACTTCACCTTCCTACGCACCCTGCCCAAAGCCCAGATCCGAAACGGCTTCGCAGAGCTCATC
AAGATCTCGTCCTGTGCCGATGCCGATACCTTTGATCTTCTTGATCGCCACTGCGAGCTCCTCATCGATACCGCC
TTTGCCCGTGCCGATGGCTCGTGTCCTGAGCTTAGACGGGCGGCTGATCGTATCTGTCGCGCTGGTATCTATGAG
ATGTTGAGGCTTGAGACGCCCAACCTCCACGAGCTGATGCTCGACCGCGTCATCGCCTACGGCCACACCTGGTCC
CCCATCTTCGAACTGGTCCCAGACCCTCCCCTTCGCCACGGCCACGCCATCTCCATCGACATGGCCTACTCAGCA
ACCCTAGCTCACAGCCGAGGCCTCCTCACGGGCCCAGACCATCAGCGTCTCCTCCGTCTCTTCTCTCGCTCAGGC
CTGGCCATGGATCACGCCGACTTCGACGCCACCATCCTCGAGCGAGCCACGGCCGCCATCCTCAAGACGCGCGAT
GGCCTCCTCCGAGCTCCCGTCCCAGTCTCGCCCCTCGGCCGCTGCCTCTTCCTCAACGACGTCTCGCACCAAGAG
ATGCGTGCCGCCCTCGAAGAGCACAAACGCATCGTCGCCGACTTTCCTCGACGAGGCGAGGGCATCGATGCCTTT
GTCGACGCCAGCGATACCGGATACACCACCGTCCAGGGGCCCGAAATCAATCATGCCGTCGTTGCCACTGTTGAC
AAGGCCGGCCGTGCCGCTCCCGAGGTCTCCGTTGCCGCCCTGCAGACAAATGGCGTGGCCTGA
Gene >Ophun1|1868
ATGTCGGACCTCAAGGCCACCGTCGACAGCACCGCCACCGGCTTCTCCGTCCGCGGCTACGAACGCATCGAGTAC
GACTTTCACTTCCTCGATGGCGTCTTCCATCCTGCCAACACGCAGCTGGCCGACTGCTACCGCGCCTGGGGCCGG
TGCCTGGCCGTCATGGACCTCAACATGCACACGCTGTACGGGGACCAGATGAGGCGCTACTTTGACACCCATTCC
ATTGCCCTCGTCGTCCACAAGACGGCCATTGGTGAAAAGGCAAAGAGCATCGAGACGCTGCTGAGCATCGTCGAC
TCGATGGATGCCTTTGGCGTCATCCGCAAGGAGCCTGTTCTTGTTGTTGGCGGCGGCCTGGTGACTGATGTGGCA
GGGTGAGGCCTTTTACTTTTGTTTCCTTGATGTTATCCGACGTGCCTCACCATGGCTCTCGATTTCTTCCATACG
GTATATGAACCCCCTCGTCTTCTGTCTTTTCCCAACTCGACCCTTGATTCTATTCCTGCCCAACGATGTACCTGC
TTGAGACACTCACCTTTGTTTCCTACCTTGTTAACTAAATCCCTCTTCCCATCCCGTTACATGGCTTCCATTCTC
TTTCCAACGGTACACCTGCCCCTTACATCTCCCCTTGTTCTCTACCTTGTTTACGACTAAATCCCTCCCCCATCT
CGCCACATGGCTTCCGTCTTGTTCCGATCAATACACCAACCCCTTTCACCCTTACACCCCCTCTTCACAACTCAT
CCCTCCCCATCCTGCAATTCTCTCAACCTCACCACTTACAACCCTCCCTTTCCAACTCGACATCTCTCCGTAACC
CAACACATCTACCCCTTTACTACGTATACCCACCCCACGATAGCCTCATCTCCCTCCTCCCAACTACACAACCCC
CCCCTAATCCTCATCCTAACCCTCCCAGCTTCGCCTGCGCCGCCTACCGCCGCAACACAAACTACATCCGCATCC
CAACCACAGTAATCGGCCTCATCGACGCCGCCGTCTCCATCAAAGTAGCCGTCAACTACGGCCGCTGCAAGAACC
GACTAGGCGCCTACCACGCCCCTCTTCACACCTTTCTCGACTTCACCTTCCTACGCACCCTGCCCAAAGCCCAGA
TCCGAAACGGCTTCGCAGAGCTCATCAAGATCTCGTCCTGTGCCGATGCCGATACCTTTGATCTTCTTGATCGCC
ACTGCGAGCTCCTCATCGATACCGCCTTTGCCCGTGCCGATGGCTCGTGTCCTGAGCTTAGACGGGCGGCTGATC
GTATCTGTCGCGCTGGTATCTATGAGATGTTGAGGCTTGAGACGCCCAACCTCCACGAGCTGATGCTCGACCGCG
TCATCGCCTACGGCCACACGTGAGTCGTCTTTGACCGTTTTCTCCCATTGCCTCTTCTCTTCCCCCCCTTCTCCT
CACCCCCCCCCCCCTCGCTCCAAACAAAAAGGGGTGACGACTCAACACTCAGCTCAGCTGGTCCCCCATCTTCGA
ACTGGTCCCAGACCCTCCCCTTCGCCACGGCCACGCCATCTCCATCGACATGGCCTACTCAGCAACCCTAGCTCA
CAGCCGAGGCCTCCTCACGGGCCCAGACCATCAGCGTCTCCTCCGTCTCTTCTCTCGCTCAGGCCTGGCCATGGA
TCACGCCGACTTCGACGCCACCATCCTCGAGCGAGCCACGGCCGCCATCCTCAAGACGCGCGATGGCCTCCTCCG
AGCTCCCGTCCCAGTCTCGCCCCTCGGCCGCTGCCTCTTCCTCAACGACGTCTCGCACCAAGAGATGCGTGCCGC
CCTCGAAGAGCACAAACGCATCGTCGCCGACTTTCCTCGACGAGGCGAGGGCATCGATGCCTTTGTCGACGCCAG
CGATACCGGATACACCACCGTCCAGGGGCCCGAAATCAATCATGCCGTCGTTGCCACTGTTGACAAGGCCGGCCG
TGCCGCTCCCGAGGTCTCCGTTGCCGCCCTGCAGACAAATGGCGTGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail