Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1865
Gene name
LocationContig_182:24040..24478
Strand+
Gene length (bp)438
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z403|LCL2_NECH7 Long chronological lifespan protein 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL2 PE=3 SV=1 21 125 5.0E-46
sp|E3QVL2|LCL2_COLGM Long chronological lifespan protein 2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL2 PE=3 SV=1 3 125 5.0E-44
sp|C9SNH6|LCL2_VERA1 Long chronological lifespan protein 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL2 PE=3 SV=1 1 125 9.0E-44
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 1 125 1.0E-43
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 1 125 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z403|LCL2_NECH7 Long chronological lifespan protein 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL2 PE=3 SV=1 21 125 5.0E-46
sp|E3QVL2|LCL2_COLGM Long chronological lifespan protein 2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL2 PE=3 SV=1 3 125 5.0E-44
sp|C9SNH6|LCL2_VERA1 Long chronological lifespan protein 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL2 PE=3 SV=1 1 125 9.0E-44
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 1 125 1.0E-43
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 1 125 1.0E-43
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 1 125 3.0E-41
sp|A1CZR3|LCL2_NEOFI Long chronological lifespan protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl2 PE=3 SV=1 4 125 6.0E-41
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 4 125 1.0E-40
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 4 125 1.0E-40
sp|B8M9Q9|LCL2_TALSN Long chronological lifespan protein 2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=lcl2 PE=3 SV=1 2 125 2.0E-40
sp|A1C4T4|LCL2_ASPCL Long chronological lifespan protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl2 PE=3 SV=1 1 125 3.0E-39
sp|Q8X0Q1|LCL2_NEUCR Long chronological lifespan protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcl2 PE=3 SV=1 49 125 8.0E-39
sp|B6HU36|LCL2_PENRW Long chronological lifespan protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl2 PE=3 SV=1 5 125 8.0E-39
sp|C5FVJ9|LCL2_ARTOC Long chronological lifespan protein 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL2 PE=3 SV=1 11 125 8.0E-39
sp|D1ZMX7|LCL2_SORMK Long chronological lifespan protein 2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=LCL2 PE=3 SV=1 49 125 1.0E-38
sp|E4UUB3|LCL2_ARTGP Long chronological lifespan protein 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LCL2 PE=3 SV=1 13 125 7.0E-38
sp|A4QUA4|LCL2_MAGO7 Long chronological lifespan protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL2 PE=3 SV=1 44 125 4.0E-37
sp|A2QUM3|LCL2_ASPNC Long chronological lifespan protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl2 PE=3 SV=1 14 125 4.0E-37
sp|B2ABT3|LCL2_PODAN Long chronological lifespan protein 2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LCL2 PE=3 SV=1 18 125 5.0E-37
sp|Q0UAF6|LCL2_PHANO Long chronological lifespan protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL2 PE=3 SV=1 3 125 5.0E-36
sp|B6QFV5|LCL2_TALMQ Long chronological lifespan protein 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lcl2 PE=3 SV=1 2 125 6.0E-36
sp|C6HEL8|LCL2_AJECH Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain H143) GN=LCL2 PE=3 SV=1 18 125 7.0E-33
sp|A6QTA3|LCL2_AJECN Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=LCL2 PE=3 SV=1 18 125 8.0E-33
sp|C0NTV7|LCL2_AJECG Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=LCL2 PE=3 SV=1 18 125 1.0E-32
sp|A6RPX6|LCL2_BOTFB Long chronological lifespan protein 2 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl2 PE=3 SV=1 18 125 3.0E-31
sp|C5GHR3|LCL2_AJEDR Long chronological lifespan protein 2 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LCL2 PE=3 SV=1 49 125 4.0E-31
sp|C5JF45|LCL2_AJEDS Long chronological lifespan protein 2 OS=Ajellomyces dermatitidis (strain SLH14081) GN=LCL2 PE=3 SV=1 49 125 4.0E-31
sp|A7E987|LCL2_SCLS1 Long chronological lifespan protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lcl2 PE=3 SV=1 18 125 6.0E-31
sp|C1GJL9|LCL2_PARBD Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL2 PE=3 SV=1 18 125 1.0E-30
sp|C0S855|LCL2_PARBP Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL2 PE=3 SV=1 18 125 1.0E-30
sp|C1H0A6|LCL2_PARBA Long chronological lifespan protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL2 PE=3 SV=1 18 125 2.0E-30
sp|E3RT14|LCL2_PYRTT Long chronological lifespan protein 2 OS=Pyrenophora teres f. teres (strain 0-1) GN=lcl2 PE=3 SV=1 18 125 2.0E-29
sp|B2WHK5|LCL2_PYRTR Long chronological lifespan protein 2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lcl2 PE=3 SV=1 50 125 5.0E-29
sp|E5A960|LCL2_LEPMJ Long chronological lifespan protein 2 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LCL2 PE=3 SV=1 50 125 6.0E-28
sp|B9WM02|LCL2_CANDC Long chronological lifespan protein 2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL2 PE=3 SV=1 8 105 1.0E-12
sp|C4YM26|LCL2_CANAW Long chronological lifespan protein 2 OS=Candida albicans (strain WO-1) GN=LCL2 PE=3 SV=1 8 105 1.0E-12
sp|Q59PT4|LCL2_CANAL Long chronological lifespan protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL2 PE=3 SV=1 8 105 1.0E-12
sp|A5DP59|LCL2_PICGU Long chronological lifespan protein 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL2 PE=3 SV=1 7 105 1.0E-10
sp|C5M3K2|LCL2_CANTT Long chronological lifespan protein 2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=LCL2 PE=3 SV=1 6 105 2.0E-10
sp|C4YAT5|LCL2_CLAL4 Long chronological lifespan protein 2 OS=Clavispora lusitaniae (strain ATCC 42720) GN=LCL2 PE=3 SV=1 6 105 8.0E-09
sp|Q6BNN2|LCL2_DEBHA Long chronological lifespan protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LCL2 PE=3 SV=1 55 105 3.0E-08
sp|C5DVG0|LCL2_ZYGRC Long chronological lifespan protein 2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LCL2 PE=3 SV=1 49 105 6.0E-08
sp|A3LY18|LCL2_PICST Long chronological lifespan protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LCL2 PE=3 SV=1 55 105 8.0E-08
sp|A5E0N1|LCL2_LODEL Long chronological lifespan protein 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LCL2 PE=3 SV=1 1 105 2.0E-07
sp|Q08045|LCL2_YEAST Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCL2 PE=1 SV=1 55 105 3.0E-07
sp|C8ZD75|LCL2_YEAS8 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LCL2 PE=3 SV=1 55 105 3.0E-07
sp|A7A108|LCL2_YEAS7 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=LCL2 PE=3 SV=1 55 105 3.0E-07
sp|C7GQS7|LCL2_YEAS2 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=LCL2 PE=3 SV=1 55 105 3.0E-07
sp|B3LT72|LCL2_YEAS1 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LCL2 PE=3 SV=1 55 105 3.0E-07
sp|C4R2P5|LCL2_PICPG Long chronological lifespan protein 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL2 PE=3 SV=1 5 125 3.0E-07
sp|A7TJ20|LCL2_VANPO Long chronological lifespan protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=LCL2 PE=3 SV=1 62 118 4.0E-07
sp|C5DMZ6|LCL2_LACTC Long chronological lifespan protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=LCL2 PE=3 SV=1 39 105 4.0E-07
sp|Q6CJB8|LCL2_KLULA Long chronological lifespan protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCL2 PE=3 SV=1 1 105 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999649

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5575
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1795
Ophiocordyceps camponoti-floridani Ophcf2|03546
Ophiocordyceps camponoti-rufipedis Ophun1|1865 (this protein)
Ophiocordyceps kimflemingae Ophio5|748
Ophiocordyceps subramaniannii Hirsu2|7311

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1865
MLSLGLVLFSLFFSVAVADFGFFEHMFGGGGGGGGPSHDHNHAQQRMNPSDASLYHSSYGGSSCDKYLCPDTLAC
VHFPHHCPCPWDANEDKFELAEGKRICVSKGGFKPGEAARKVELARKGLL*
Coding >Ophun1|1865
ATGTTATCTCTCGGCCTCGTTCTCTTTTCTCTCTTCTTCTCCGTCGCCGTCGCAGATTTTGGCTTCTTTGAGCAC
ATGTTTGGCGGTGGAGGCGGCGGCGGCGGCCCAAGTCACGACCACAACCACGCACAGCAACGCATGAACCCCAGC
GACGCATCGCTCTACCATTCCTCCTACGGCGGCTCCTCATGTGACAAGTATCTCTGTCCCGATACCCTCGCCTGC
GTCCACTTTCCGCACCACTGCCCCTGTCCCTGGGATGCCAACGAAGACAAGTTCGAGCTCGCCGAAGGGAAGCGC
ATTTGCGTGTCCAAGGGCGGCTTCAAGCCAGGCGAGGCGGCGCGCAAGGTCGAGCTGGCGCGCAAGGGGCTCTTA
TAA
Transcript >Ophun1|1865
ATGTTATCTCTCGGCCTCGTTCTCTTTTCTCTCTTCTTCTCCGTCGCCGTCGCAGATTTTGGCTTCTTTGAGCAC
ATGTTTGGCGGTGGAGGCGGCGGCGGCGGCCCAAGTCACGACCACAACCACGCACAGCAACGCATGAACCCCAGC
GACGCATCGCTCTACCATTCCTCCTACGGCGGCTCCTCATGTGACAAGTATCTCTGTCCCGATACCCTCGCCTGC
GTCCACTTTCCGCACCACTGCCCCTGTCCCTGGGATGCCAACGAAGACAAGTTCGAGCTCGCCGAAGGGAAGCGC
ATTTGCGTGTCCAAGGGCGGCTTCAAGCCAGGCGAGGCGGCGCGCAAGGTCGAGCTGGCGCGCAAGGGGCTCTTA
TAA
Gene >Ophun1|1865
ATGTTATCTCTCGGCCTCGTTCTCTTTTCTCTCTTCTTCTCCGTCGCCGTCGCAGATTTTGGCTTCTTTGAGCAC
ATGTTTGGCGGTGGAGGCGGCGGCGGCGGCCCAAGTCACGACCACAACCACGCACAGCAACGCATGAACCCCAGC
GACGCATCGCTCTACCATTCCTCCTACGGCGGCTGTCTGTTTCCCTTGCACCTTGCTCTAATACTCACTGGCTGA
CCGTGTTGTTCTTTTGTAGCCTCATGTGACAAGTATCTCTGTCCCGATACCCTCGCCTGCGTCCACTTTCCGCAC
CACTGCCCCTGTCCCTGGGATGCCAACGAAGACAAGTTCGAGCTCGCCGAAGGGAAGCGCATTTGCGTGTCCAAG
GGCGGCTTCAAGCCAGGCGAGGCGGCGCGCAAGGTCGAGCTGGCGCGCAAGGGGCTCTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail