Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1864
Gene name
LocationContig_182:22928..23845
Strand-
Gene length (bp)917
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01016 Ribosomal_L27 Ribosomal L27 protein 4.0E-27 31 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C9C4|RM02_YARLI 54S ribosomal protein L2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPL2 PE=3 SV=1 14 144 1.0E-23
sp|Q6BIE4|RM02_DEBHA 54S ribosomal protein L2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPL2 PE=3 SV=1 29 150 1.0E-20
sp|Q6FS31|RM02_CANGA 54S ribosomal protein L2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPL2 PE=3 SV=1 29 138 3.0E-20
sp|Q9HDV5|RM02_SCHPO 54S ribosomal protein L27, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp7 PE=3 SV=1 31 134 1.0E-19
sp|P12687|RM02_YEAST 54S ribosomal protein L2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP7 PE=1 SV=1 29 138 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C9C4|RM02_YARLI 54S ribosomal protein L2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPL2 PE=3 SV=1 14 144 1.0E-23
sp|Q6BIE4|RM02_DEBHA 54S ribosomal protein L2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPL2 PE=3 SV=1 29 150 1.0E-20
sp|Q6FS31|RM02_CANGA 54S ribosomal protein L2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPL2 PE=3 SV=1 29 138 3.0E-20
sp|Q9HDV5|RM02_SCHPO 54S ribosomal protein L27, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp7 PE=3 SV=1 31 134 1.0E-19
sp|P12687|RM02_YEAST 54S ribosomal protein L2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP7 PE=1 SV=1 29 138 2.0E-18
sp|P48535|RM02_KLULA 54S ribosomal protein L2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPL2 PE=3 SV=2 29 135 2.0E-18
sp|Q75ET6|RM02_ASHGO 54S ribosomal protein L2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL2 PE=3 SV=1 29 135 2.0E-17
sp|P0CQ48|RM27_CRYNJ 54S ribosomal protein L27, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPL27 PE=3 SV=1 34 123 8.0E-17
sp|P0CQ49|RM27_CRYNB 54S ribosomal protein L27, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPL27 PE=3 SV=1 34 123 8.0E-17
sp|A8LK04|RL27_DINSH 50S ribosomal protein L27 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpmA PE=3 SV=1 34 99 1.0E-14
sp|Q30QN9|RL27_SULDN 50S ribosomal protein L27 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpmA PE=3 SV=1 34 101 2.0E-14
sp|A1B9H4|RL27_PARDP 50S ribosomal protein L27 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpmA PE=3 SV=1 34 115 4.0E-14
sp|Q54XK0|RM27_DICDI Probable 39S ribosomal protein L27, mitochondrial OS=Dictyostelium discoideum GN=mrpl27 PE=3 SV=1 19 104 4.0E-14
sp|Q13DL3|RL27_RHOPS 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpmA PE=3 SV=1 34 99 8.0E-14
sp|A7HT69|RL27_PARL1 50S ribosomal protein L27 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpmA PE=3 SV=1 34 119 8.0E-14
sp|Q2NCD6|RL27_ERYLH 50S ribosomal protein L27 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpmA PE=3 SV=1 34 114 1.0E-13
sp|B6JD23|RL27_OLICO 50S ribosomal protein L27 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpmA PE=3 SV=1 34 99 2.0E-13
sp|Q3J6S1|RL27_NITOC 50S ribosomal protein L27 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpmA PE=3 SV=1 34 115 2.0E-13
sp|Q1QQU2|RL27_NITHX 50S ribosomal protein L27 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpmA PE=3 SV=1 34 99 2.0E-13
sp|B1M699|RL27_METRJ 50S ribosomal protein L27 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpmA PE=3 SV=1 34 115 2.0E-13
sp|Q8UBR6|RL27_AGRFC 50S ribosomal protein L27 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpmA PE=3 SV=1 34 99 3.0E-13
sp|Q2J3K2|RL27_RHOP2 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpmA PE=3 SV=1 34 99 4.0E-13
sp|Q21D07|RL27_RHOPB 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpmA PE=3 SV=1 34 99 4.0E-13
sp|B3Q726|RL27_RHOPT 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpmA PE=3 SV=1 34 99 6.0E-13
sp|Q6NDE9|RL27_RHOPA 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpmA PE=1 SV=1 34 99 6.0E-13
sp|B1ZL17|RL27_METPB 50S ribosomal protein L27 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpmA PE=3 SV=1 34 115 7.0E-13
sp|B8IEL7|RL27_METNO 50S ribosomal protein L27 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpmA PE=3 SV=1 34 115 1.0E-12
sp|A9VYM7|RL27_METEP 50S ribosomal protein L27 OS=Methylobacterium extorquens (strain PA1) GN=rpmA PE=3 SV=1 34 115 1.0E-12
sp|B7KSH3|RL27_METC4 50S ribosomal protein L27 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpmA PE=3 SV=1 34 115 1.0E-12
sp|A9IM57|RL27_BART1 50S ribosomal protein L27 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpmA PE=3 SV=1 34 115 1.0E-12
sp|Q3IXY1|RL27_RHOS4 50S ribosomal protein L27 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpmA PE=3 SV=1 34 99 1.0E-12
sp|A3PQI8|RL27_RHOS1 50S ribosomal protein L27 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpmA PE=3 SV=1 34 99 1.0E-12
sp|Q2VZU3|RL27_MAGSA 50S ribosomal protein L27 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpmA PE=3 SV=1 34 104 1.0E-12
sp|B9JUI3|RL27_AGRVS 50S ribosomal protein L27 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpmA PE=3 SV=1 34 99 2.0E-12
sp|Q165Y3|RL27_ROSDO 50S ribosomal protein L27 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpmA PE=3 SV=1 34 129 2.0E-12
sp|C3PLM9|RL27_RICAE 50S ribosomal protein L27 OS=Rickettsia africae (strain ESF-5) GN=rpmA PE=3 SV=1 32 99 2.0E-12
sp|A9H0E8|RL27_GLUDA 50S ribosomal protein L27 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpmA PE=3 SV=1 34 104 2.0E-12
sp|A7IH94|RL27_XANP2 50S ribosomal protein L27 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpmA PE=3 SV=1 34 115 2.0E-12
sp|Q11CP4|RL27_CHESB 50S ribosomal protein L27 OS=Chelativorans sp. (strain BNC1) GN=rpmA PE=3 SV=1 34 114 2.0E-12
sp|Q07U70|RL27_RHOP5 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpmA PE=3 SV=1 34 99 3.0E-12
sp|Q3SKG3|RL27_THIDA 50S ribosomal protein L27 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpmA PE=3 SV=1 34 99 3.0E-12
sp|A5E968|RL27_BRASB 50S ribosomal protein L27 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpmA PE=3 SV=1 34 105 3.0E-12
sp|A9KEJ8|RL27_COXBN 50S ribosomal protein L27 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpmA PE=3 SV=1 34 101 3.0E-12
sp|A4YKF6|RL27_BRASO 50S ribosomal protein L27 OS=Bradyrhizobium sp. (strain ORS278) GN=rpmA PE=3 SV=1 34 100 3.0E-12
sp|A8HRT6|RL27_AZOC5 50S ribosomal protein L27 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpmA PE=3 SV=1 34 115 3.0E-12
sp|A6QB71|RL27_SULNB 50S ribosomal protein L27 OS=Sulfurovum sp. (strain NBC37-1) GN=rpmA PE=3 SV=1 34 99 3.0E-12
sp|Q83ED9|RL27_COXBU 50S ribosomal protein L27 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpmA PE=3 SV=1 34 101 4.0E-12
sp|A9NBL4|RL27_COXBR 50S ribosomal protein L27 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpmA PE=3 SV=1 34 101 4.0E-12
sp|B6J1S9|RL27_COXB2 50S ribosomal protein L27 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpmA PE=3 SV=1 34 101 4.0E-12
sp|B6J9K3|RL27_COXB1 50S ribosomal protein L27 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpmA PE=3 SV=1 34 101 4.0E-12
sp|A0RR38|RL27_CAMFF 50S ribosomal protein L27 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpmA PE=3 SV=1 34 114 4.0E-12
sp|Q5LRY1|RL27_RUEPO 50S ribosomal protein L27 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpmA PE=3 SV=1 34 129 4.0E-12
sp|C5BQB3|RL27_TERTT 50S ribosomal protein L27 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpmA PE=3 SV=1 34 115 4.0E-12
sp|A6UDV3|RL27_SINMW 50S ribosomal protein L27 OS=Sinorhizobium medicae (strain WSM419) GN=rpmA PE=3 SV=1 34 119 4.0E-12
sp|A0M7D0|RL27_GRAFK 50S ribosomal protein L27 OS=Gramella forsetii (strain KT0803) GN=rpmA PE=3 SV=1 36 114 5.0E-12
sp|B9L606|RL27_NAUPA 50S ribosomal protein L27 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpmA PE=3 SV=1 31 105 5.0E-12
sp|Q92GG0|RL27_RICCN 50S ribosomal protein L27 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpmA PE=3 SV=1 32 99 5.0E-12
sp|B4RD67|RL27_PHEZH 50S ribosomal protein L27 OS=Phenylobacterium zucineum (strain HLK1) GN=rpmA PE=3 SV=1 34 115 6.0E-12
sp|A1KAC9|RL27_AZOSB 50S ribosomal protein L27 OS=Azoarcus sp. (strain BH72) GN=rpmA PE=3 SV=1 34 99 6.0E-12
sp|Q4UK85|RL27_RICFE 50S ribosomal protein L27 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpmA PE=3 SV=1 32 99 6.0E-12
sp|Q28Q14|RL27_JANSC 50S ribosomal protein L27 OS=Jannaschia sp. (strain CCS1) GN=rpmA PE=3 SV=1 34 99 7.0E-12
sp|A0LCZ4|RL27_MAGMM 50S ribosomal protein L27 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpmA PE=3 SV=1 34 99 7.0E-12
sp|A8F2N7|RL27_RICM5 50S ribosomal protein L27 OS=Rickettsia massiliae (strain Mtu5) GN=rpmA PE=3 SV=1 32 99 8.0E-12
sp|A8GTK7|RL27_RICRS 50S ribosomal protein L27 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpmA PE=3 SV=1 32 100 8.0E-12
sp|B0BV44|RL27_RICRO 50S ribosomal protein L27 OS=Rickettsia rickettsii (strain Iowa) GN=rpmA PE=3 SV=1 32 100 8.0E-12
sp|C4K1G6|RL27_RICPU 50S ribosomal protein L27 OS=Rickettsia peacockii (strain Rustic) GN=rpmA PE=3 SV=1 32 100 8.0E-12
sp|A8EZV2|RL27_RICCK 50S ribosomal protein L27 OS=Rickettsia canadensis (strain McKiel) GN=rpmA PE=3 SV=1 32 99 8.0E-12
sp|A5FV28|RL27_ACICJ 50S ribosomal protein L27 OS=Acidiphilium cryptum (strain JF-5) GN=rpmA PE=3 SV=1 34 104 9.0E-12
sp|Q98EZ0|RL27_RHILO 50S ribosomal protein L27 OS=Rhizobium loti (strain MAFF303099) GN=rpmA PE=3 SV=1 34 114 9.0E-12
sp|Q1GRH1|RL27_SPHAL 50S ribosomal protein L27 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpmA PE=3 SV=1 34 114 9.0E-12
sp|Q7MA29|RL27_WOLSU 50S ribosomal protein L27 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpmA PE=3 SV=1 34 105 1.0E-11
sp|Q5P7Z5|RL27_AROAE 50S ribosomal protein L27 OS=Aromatoleum aromaticum (strain EbN1) GN=rpmA PE=3 SV=1 34 99 1.0E-11
sp|A5FJP6|RL27_FLAJ1 50S ribosomal protein L27 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpmA PE=3 SV=1 36 115 1.0E-11
sp|B5ZUD9|RL27_RHILW 50S ribosomal protein L27 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpmA PE=3 SV=1 34 119 1.0E-11
sp|Q1MA80|RL27_RHIL3 50S ribosomal protein L27 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpmA PE=3 SV=1 34 119 1.0E-11
sp|Q2K2Y0|RL27_RHIEC 50S ribosomal protein L27 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpmA PE=3 SV=1 34 119 1.0E-11
sp|B3PRY9|RL27_RHIE6 50S ribosomal protein L27 OS=Rhizobium etli (strain CIAT 652) GN=rpmA PE=3 SV=1 34 119 1.0E-11
sp|Q2G9U8|RL27_NOVAD 50S ribosomal protein L27 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpmA PE=3 SV=1 34 114 1.0E-11
sp|Q89X93|RL27_BRADU 50S ribosomal protein L27 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpmA PE=3 SV=1 34 99 1.0E-11
sp|Q92LB7|RL27_RHIME 50S ribosomal protein L27 OS=Rhizobium meliloti (strain 1021) GN=rpmA PE=3 SV=1 34 119 2.0E-11
sp|B6IR00|RL27_RHOCS 50S ribosomal protein L27 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpmA PE=3 SV=1 34 123 2.0E-11
sp|B9JEQ8|RL27_AGRRK 50S ribosomal protein L27 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpmA PE=3 SV=1 34 119 2.0E-11
sp|Q3SVI4|RL27_NITWN 50S ribosomal protein L27 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpmA PE=3 SV=1 34 99 2.0E-11
sp|Q0BZ41|RL27_HYPNA 50S ribosomal protein L27 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpmA PE=3 SV=1 34 115 2.0E-11
sp|Q1GHD2|RL27_RUEST 50S ribosomal protein L27 OS=Ruegeria sp. (strain TM1040) GN=rpmA PE=3 SV=1 34 115 2.0E-11
sp|P30155|RK27_TOBAC 50S ribosomal protein L27, chloroplastic OS=Nicotiana tabacum GN=RPL27 PE=1 SV=1 32 129 2.0E-11
sp|B5ELU3|RL27_ACIF5 50S ribosomal protein L27 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpmA PE=3 SV=1 34 101 3.0E-11
sp|B7J428|RL27_ACIF2 50S ribosomal protein L27 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpmA PE=3 SV=1 34 101 3.0E-11
sp|A6H1P8|RL27_FLAPJ 50S ribosomal protein L27 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpmA PE=3 SV=1 41 115 3.0E-11
sp|Q5HX71|RL27_CAMJR 50S ribosomal protein L27 OS=Campylobacter jejuni (strain RM1221) GN=rpmA PE=3 SV=1 34 114 4.0E-11
sp|A1VXH8|RL27_CAMJJ 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpmA PE=3 SV=1 34 114 4.0E-11
sp|Q9PJ31|RL27_CAMJE 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpmA PE=3 SV=1 34 114 4.0E-11
sp|A7H1G9|RL27_CAMJD 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpmA PE=3 SV=1 34 114 4.0E-11
sp|A8FJQ0|RL27_CAMJ8 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpmA PE=3 SV=1 34 114 4.0E-11
sp|Q6G0T7|RL27_BARQU 50S ribosomal protein L27 OS=Bartonella quintana (strain Toulouse) GN=rpmA PE=3 SV=1 34 115 4.0E-11
sp|A5CF98|RL27_ORITB 50S ribosomal protein L27 OS=Orientia tsutsugamushi (strain Boryong) GN=rpmA PE=3 SV=1 32 115 4.0E-11
sp|Q2GK21|RL27_ANAPZ 50S ribosomal protein L27 OS=Anaplasma phagocytophilum (strain HZ) GN=rpmA PE=3 SV=1 32 104 5.0E-11
sp|C3M9X6|RL27_RHISN 50S ribosomal protein L27 OS=Rhizobium sp. (strain NGR234) GN=rpmA PE=3 SV=1 34 99 6.0E-11
sp|B0UMS2|RL27_METS4 50S ribosomal protein L27 OS=Methylobacterium sp. (strain 4-46) GN=rpmA PE=3 SV=1 34 99 6.0E-11
sp|Q0AKX6|RL27_MARMM 50S ribosomal protein L27 OS=Maricaulis maris (strain MCS10) GN=rpmA PE=3 SV=1 34 101 7.0E-11
sp|B2IE46|RL27_BEII9 50S ribosomal protein L27 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpmA PE=3 SV=1 34 115 7.0E-11
sp|A6Q4D3|RL27_NITSB 50S ribosomal protein L27 OS=Nitratiruptor sp. (strain SB155-2) GN=rpmA PE=3 SV=1 34 101 7.0E-11
sp|Q21M08|RL27_SACD2 50S ribosomal protein L27 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpmA PE=3 SV=1 34 115 8.0E-11
sp|B0T395|RL27_CAUSK 50S ribosomal protein L27 OS=Caulobacter sp. (strain K31) GN=rpmA PE=3 SV=1 34 114 9.0E-11
sp|Q3YRY1|RL27_EHRCJ 50S ribosomal protein L27 OS=Ehrlichia canis (strain Jake) GN=rpmA PE=3 SV=1 32 101 9.0E-11
sp|Q6G507|RL27_BARHE 50S ribosomal protein L27 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpmA PE=3 SV=1 34 115 1.0E-10
sp|B9KER2|RL27_CAMLR 50S ribosomal protein L27 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpmA PE=3 SV=1 34 101 1.0E-10
sp|B3CV08|RL27_ORITI 50S ribosomal protein L27 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpmA PE=3 SV=1 32 115 1.0E-10
sp|B9K8D0|RL27_THENN 50S ribosomal protein L27 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpmA PE=3 SV=1 34 114 1.0E-10
sp|O65037|RK27_ORYSJ 50S ribosomal protein L27, chloroplastic OS=Oryza sativa subsp. japonica GN=RPL27 PE=2 SV=1 36 114 1.0E-10
sp|Q8EVW5|RL27_MYCPE 50S ribosomal protein L27 OS=Mycoplasma penetrans (strain HF-2) GN=rpmA PE=3 SV=1 31 99 2.0E-10
sp|B1LBJ4|RL27_THESQ 50S ribosomal protein L27 OS=Thermotoga sp. (strain RQ2) GN=rpmA PE=3 SV=1 34 114 2.0E-10
sp|A5IMC9|RL27_THEP1 50S ribosomal protein L27 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpmA PE=3 SV=1 34 114 2.0E-10
sp|Q9X1G7|RL27_THEMA 50S ribosomal protein L27 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpmA PE=3 SV=1 34 114 2.0E-10
sp|Q24SN8|RL27_DESHY 50S ribosomal protein L27 OS=Desulfitobacterium hafniense (strain Y51) GN=rpmA PE=3 SV=1 48 101 2.0E-10
sp|B8FUS1|RL27_DESHD 50S ribosomal protein L27 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpmA PE=3 SV=1 48 101 2.0E-10
sp|B2UNV3|RL27_AKKM8 50S ribosomal protein L27 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpmA PE=3 SV=1 34 105 2.0E-10
sp|C3K1X7|RL27_PSEFS 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain SBW25) GN=rpmA PE=3 SV=1 34 115 2.0E-10
sp|Q2S9T2|RL27_HAHCH 50S ribosomal protein L27 OS=Hahella chejuensis (strain KCTC 2396) GN=rpmA PE=3 SV=1 31 99 2.0E-10
sp|Q5NR21|RL27_ZYMMO 50S ribosomal protein L27 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpmA PE=3 SV=1 34 125 2.0E-10
sp|A8GPP8|RL27_RICAH 50S ribosomal protein L27 OS=Rickettsia akari (strain Hartford) GN=rpmA PE=3 SV=1 32 99 2.0E-10
sp|Q8CS89|RL27_STAES 50S ribosomal protein L27 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpmA PE=3 SV=1 36 101 3.0E-10
sp|Q5HNQ6|RL27_STAEQ 50S ribosomal protein L27 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpmA PE=3 SV=1 36 101 3.0E-10
sp|Q4ZYK2|RL27_PSEU2 50S ribosomal protein L27 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpmA PE=3 SV=1 34 119 3.0E-10
sp|Q889F2|RL27_PSESM 50S ribosomal protein L27 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpmA PE=3 SV=1 34 119 3.0E-10
sp|Q48NL3|RL27_PSE14 50S ribosomal protein L27 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpmA PE=3 SV=1 34 119 3.0E-10
sp|Q9FLN4|RK27_ARATH 50S ribosomal protein L27, chloroplastic OS=Arabidopsis thaliana GN=RPL27 PE=2 SV=1 32 133 3.0E-10
sp|Q5PAS8|RL27_ANAMM 50S ribosomal protein L27 OS=Anaplasma marginale (strain St. Maries) GN=rpmA PE=3 SV=1 32 101 3.0E-10
sp|B9KIJ4|RL27_ANAMF 50S ribosomal protein L27 OS=Anaplasma marginale (strain Florida) GN=rpmA PE=3 SV=1 32 101 3.0E-10
sp|Q49Y83|RL27_STAS1 50S ribosomal protein L27 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpmA PE=3 SV=1 41 114 3.0E-10
sp|Q0VSE7|RL27_ALCBS 50S ribosomal protein L27 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpmA PE=3 SV=1 34 112 4.0E-10
sp|Q1RGM8|RL27_RICBR 50S ribosomal protein L27 OS=Rickettsia bellii (strain RML369-C) GN=rpmA PE=3 SV=1 32 99 4.0E-10
sp|A8GYB3|RL27_RICB8 50S ribosomal protein L27 OS=Rickettsia bellii (strain OSU 85-389) GN=rpmA PE=3 SV=1 32 99 4.0E-10
sp|A6LQR8|RL27_CLOB8 50S ribosomal protein L27 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpmA PE=3 SV=1 36 101 4.0E-10
sp|Q4L6Z1|RL27_STAHJ 50S ribosomal protein L27 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpmA PE=3 SV=1 36 101 4.0E-10
sp|P66134|RL27_STAAW 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MW2) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|A8Z2H3|RL27_STAAT 50S ribosomal protein L27 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|Q6G8S4|RL27_STAAS 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MSSA476) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|Q6GG59|RL27_STAAR 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MRSA252) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|P66133|RL27_STAAN 50S ribosomal protein L27 OS=Staphylococcus aureus (strain N315) GN=rpmA PE=1 SV=1 36 114 4.0E-10
sp|Q931Q3|RL27_STAAM 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpmA PE=3 SV=3 36 114 4.0E-10
sp|A6QHI7|RL27_STAAE 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Newman) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|Q5HFB8|RL27_STAAC 50S ribosomal protein L27 OS=Staphylococcus aureus (strain COL) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|Q2YT85|RL27_STAAB 50S ribosomal protein L27 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|A5ITG9|RL27_STAA9 50S ribosomal protein L27 OS=Staphylococcus aureus (strain JH9) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|Q2FXT0|RL27_STAA8 50S ribosomal protein L27 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpmA PE=1 SV=1 36 114 4.0E-10
sp|Q2FG82|RL27_STAA3 50S ribosomal protein L27 OS=Staphylococcus aureus (strain USA300) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|A6U2B3|RL27_STAA2 50S ribosomal protein L27 OS=Staphylococcus aureus (strain JH1) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|A7X362|RL27_STAA1 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpmA PE=3 SV=1 36 114 4.0E-10
sp|C0R0P3|RL27_BRAHW 50S ribosomal protein L27 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rpmA PE=3 SV=1 34 102 4.0E-10
sp|Q2GGS4|RL27_EHRCR 50S ribosomal protein L27 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpmA PE=3 SV=1 32 101 5.0E-10
sp|Q65GM5|RL27_BACLD 50S ribosomal protein L27 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpmA PE=3 SV=1 31 101 6.0E-10
sp|Q3IFF5|RL27_PSEHT 50S ribosomal protein L27 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpmA PE=3 SV=1 34 115 6.0E-10
sp|B0SRT6|RL27_LEPBP 50S ribosomal protein L27 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpmA PE=3 SV=1 32 99 6.0E-10
sp|B0S9A2|RL27_LEPBA 50S ribosomal protein L27 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpmA PE=3 SV=1 32 99 6.0E-10
sp|A8FFT0|RL27_BACP2 50S ribosomal protein L27 OS=Bacillus pumilus (strain SAFR-032) GN=rpmA PE=3 SV=1 31 101 7.0E-10
sp|A4XJS7|RL27_CALS8 50S ribosomal protein L27 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpmA PE=3 SV=1 34 115 7.0E-10
sp|B9MRB7|RL27_CALBD 50S ribosomal protein L27 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpmA PE=3 SV=1 34 115 8.0E-10
sp|A7MJF4|RL27_CROS8 50S ribosomal protein L27 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpmA PE=3 SV=1 34 115 8.0E-10
sp|B9L2M3|RL27_THERP 50S ribosomal protein L27 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpmA PE=3 SV=1 34 99 8.0E-10
sp|A4WEZ8|RL27_ENT38 50S ribosomal protein L27 OS=Enterobacter sp. (strain 638) GN=rpmA PE=3 SV=1 34 115 8.0E-10
sp|B8EQH6|RL27_METSB 50S ribosomal protein L27 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpmA PE=3 SV=1 34 119 9.0E-10
sp|A7Z783|RL27_BACMF 50S ribosomal protein L27 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpmA PE=3 SV=1 31 101 9.0E-10
sp|P05657|RL27_BACSU 50S ribosomal protein L27 OS=Bacillus subtilis (strain 168) GN=rpmA PE=1 SV=1 31 101 9.0E-10
sp|P41545|RK27_CHRCT 50S ribosomal protein L27, chloroplastic OS=Chrysotila carteri GN=rpl27 PE=3 SV=1 36 115 9.0E-10
sp|A8AQ77|RL27_CITK8 50S ribosomal protein L27 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpmA PE=3 SV=1 34 115 9.0E-10
sp|P66131|RL27_SALTY 50S ribosomal protein L27 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpmA PE=3 SV=2 34 115 1.0E-09
sp|P66132|RL27_SALTI 50S ribosomal protein L27 OS=Salmonella typhi GN=rpmA PE=3 SV=2 34 115 1.0E-09
sp|B4TWF5|RL27_SALSV 50S ribosomal protein L27 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B5BGK9|RL27_SALPK 50S ribosomal protein L27 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|C0PZJ7|RL27_SALPC 50S ribosomal protein L27 OS=Salmonella paratyphi C (strain RKS4594) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|A9N752|RL27_SALPB 50S ribosomal protein L27 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q5PLB5|RL27_SALPA 50S ribosomal protein L27 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpmA PE=3 SV=3 34 115 1.0E-09
sp|B4T716|RL27_SALNS 50S ribosomal protein L27 OS=Salmonella newport (strain SL254) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B4TJ23|RL27_SALHS 50S ribosomal protein L27 OS=Salmonella heidelberg (strain SL476) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B5REQ1|RL27_SALG2 50S ribosomal protein L27 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B5R0H6|RL27_SALEP 50S ribosomal protein L27 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B5FIN4|RL27_SALDC 50S ribosomal protein L27 OS=Salmonella dublin (strain CT_02021853) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q57JG5|RL27_SALCH 50S ribosomal protein L27 OS=Salmonella choleraesuis (strain SC-B67) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|A9MP21|RL27_SALAR 50S ribosomal protein L27 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|B5F6V4|RL27_SALA4 50S ribosomal protein L27 OS=Salmonella agona (strain SL483) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q5WTF0|RL27_LEGPL 50S ribosomal protein L27 OS=Legionella pneumophila (strain Lens) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q5ZS69|RL27_LEGPH 50S ribosomal protein L27 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|A5IAS6|RL27_LEGPC 50S ribosomal protein L27 OS=Legionella pneumophila (strain Corby) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q5X1P0|RL27_LEGPA 50S ribosomal protein L27 OS=Legionella pneumophila (strain Paris) GN=rpmA PE=3 SV=1 34 115 1.0E-09
sp|Q17Y99|RL27_HELAH 50S ribosomal protein L27 OS=Helicobacter acinonychis (strain Sheeba) GN=rpmA PE=3 SV=1 31 105 1.0E-09
sp|O67650|RL27_AQUAE 50S ribosomal protein L27 OS=Aquifex aeolicus (strain VF5) GN=rpmA PE=3 SV=1 34 99 1.0E-09
sp|Q6MGS4|RL27_BDEBA 50S ribosomal protein L27 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpmA PE=3 SV=1 31 101 1.0E-09
sp|Q9ZCI8|RL27_RICPR 50S ribosomal protein L27 OS=Rickettsia prowazekii (strain Madrid E) GN=rpmA PE=3 SV=1 32 99 2.0E-09
sp|Q88Q09|RL27_PSEPK 50S ribosomal protein L27 OS=Pseudomonas putida (strain KT2440) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|B0KMF5|RL27_PSEPG 50S ribosomal protein L27 OS=Pseudomonas putida (strain GB-1) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|A5VYC5|RL27_PSEP1 50S ribosomal protein L27 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|Q1IF14|RL27_PSEE4 50S ribosomal protein L27 OS=Pseudomonas entomophila (strain L48) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|A1URM7|RL27_BARBK 50S ribosomal protein L27 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|B8E0B3|RL27_DICTD 50S ribosomal protein L27 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpmA PE=3 SV=1 34 115 2.0E-09
sp|Q4FP47|RL27_PELUB 50S ribosomal protein L27 OS=Pelagibacter ubique (strain HTCC1062) GN=rpmA PE=3 SV=1 32 114 2.0E-09
sp|Q8EPP8|RL27_OCEIH 50S ribosomal protein L27 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpmA PE=3 SV=1 34 101 2.0E-09
sp|C1D505|RL27_LARHH 50S ribosomal protein L27 OS=Laribacter hongkongensis (strain HLHK9) GN=rpmA PE=3 SV=1 34 99 2.0E-09
sp|Q2GCN3|RL27_NEOSM 50S ribosomal protein L27 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpmA PE=3 SV=1 32 99 3.0E-09
sp|Q68VZ8|RL27_RICTY 50S ribosomal protein L27 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpmA PE=3 SV=1 32 99 3.0E-09
sp|A1KVV9|RL27_NEIMF 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpmA PE=3 SV=1 31 99 3.0E-09
sp|P66130|RL27_NEIMB 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpmA PE=3 SV=1 31 99 3.0E-09
sp|P66129|RL27_NEIMA 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpmA PE=3 SV=1 31 99 3.0E-09
sp|A9M2Z6|RL27_NEIM0 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpmA PE=3 SV=1 31 99 3.0E-09
sp|B7GNK2|RL27_BIFLS 50S ribosomal protein L27 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpmA PE=3 SV=1 36 115 3.0E-09
sp|Q8G4U1|RL27_BIFLO 50S ribosomal protein L27 OS=Bifidobacterium longum (strain NCC 2705) GN=rpmA PE=3 SV=1 36 115 3.0E-09
sp|B3DPS3|RL27_BIFLD 50S ribosomal protein L27 OS=Bifidobacterium longum (strain DJO10A) GN=rpmA PE=3 SV=1 36 115 3.0E-09
sp|Q5HB48|RL27_EHRRW 50S ribosomal protein L27 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpmA PE=3 SV=1 32 101 3.0E-09
sp|Q5FH97|RL27_EHRRG 50S ribosomal protein L27 OS=Ehrlichia ruminantium (strain Gardel) GN=rpmA PE=3 SV=1 32 101 3.0E-09
sp|A4XYL3|RL27_PSEMY 50S ribosomal protein L27 OS=Pseudomonas mendocina (strain ymp) GN=rpmA PE=3 SV=1 34 115 3.0E-09
sp|A6WXR7|RL27_OCHA4 50S ribosomal protein L27 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpmA PE=3 SV=1 34 99 3.0E-09
sp|Q2RV03|RL27_RHORT 50S ribosomal protein L27 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpmA PE=3 SV=1 34 101 3.0E-09
sp|B4RNP1|RL27_NEIG2 50S ribosomal protein L27 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpmA PE=3 SV=1 31 99 4.0E-09
sp|Q5F685|RL27_NEIG1 50S ribosomal protein L27 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpmA PE=3 SV=1 31 99 4.0E-09
sp|Q2Y808|RL27_NITMU 50S ribosomal protein L27 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpmA PE=3 SV=1 34 115 5.0E-09
sp|Q8FYL8|RL27_BRUSU 50S ribosomal protein L27 OS=Brucella suis biovar 1 (strain 1330) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|A9WWX2|RL27_BRUSI 50S ribosomal protein L27 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|A5VSI8|RL27_BRUO2 50S ribosomal protein L27 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|C0RF97|RL27_BRUMB 50S ribosomal protein L27 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|A9M886|RL27_BRUC2 50S ribosomal protein L27 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|Q8VW58|RL27_BRUAB 50S ribosomal protein L27 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|Q2YLL8|RL27_BRUA2 50S ribosomal protein L27 OS=Brucella abortus (strain 2308) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|B2S810|RL27_BRUA1 50S ribosomal protein L27 OS=Brucella abortus (strain S19) GN=rpmA PE=3 SV=1 34 99 5.0E-09
sp|Q8RBA7|RL27_CALS4 50S ribosomal protein L27 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpmA PE=3 SV=1 36 101 5.0E-09
sp|B7GIR0|RL27_ANOFW 50S ribosomal protein L27 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpmA PE=3 SV=1 31 101 6.0E-09
sp|B2V8X4|RL27_SULSY 50S ribosomal protein L27 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpmA PE=3 SV=1 34 99 6.0E-09
sp|B2V0A7|RL27_CLOBA 50S ribosomal protein L27 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpmA PE=3 SV=1 36 101 6.0E-09
sp|B2TK69|RL27_CLOBB 50S ribosomal protein L27 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpmA PE=3 SV=1 36 101 6.0E-09
sp|B2A6B5|RL27_NATTJ 50S ribosomal protein L27 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpmA PE=3 SV=1 30 99 6.0E-09
sp|P56050|RL27_HELPY 50S ribosomal protein L27 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpmA PE=3 SV=1 31 115 8.0E-09
sp|B2USC8|RL27_HELPS 50S ribosomal protein L27 OS=Helicobacter pylori (strain Shi470) GN=rpmA PE=3 SV=1 31 115 8.0E-09
sp|Q1CUK6|RL27_HELPH 50S ribosomal protein L27 OS=Helicobacter pylori (strain HPAG1) GN=rpmA PE=3 SV=1 31 115 8.0E-09
sp|B5ZA63|RL27_HELPG 50S ribosomal protein L27 OS=Helicobacter pylori (strain G27) GN=rpmA PE=3 SV=1 31 115 8.0E-09
sp|B6JKM6|RL27_HELP2 50S ribosomal protein L27 OS=Helicobacter pylori (strain P12) GN=rpmA PE=3 SV=1 31 115 8.0E-09
sp|Q6F8G2|RL27_ACIAD 50S ribosomal protein L27 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpmA PE=3 SV=1 31 99 8.0E-09
sp|Q8YJ84|RL27_BRUME 50S ribosomal protein L27 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpmA PE=3 SV=1 36 99 9.0E-09
sp|Q7VK83|RL27_HELHP 50S ribosomal protein L27 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpmA PE=3 SV=1 31 115 9.0E-09
sp|B0VEJ5|RL27_ACIBY 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AYE) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|A3M899|RL27_ACIBT 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|B0VSH6|RL27_ACIBS 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain SDF) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|B2HXU8|RL27_ACIBC 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain ACICU) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|B7I6V8|RL27_ACIB5 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AB0057) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|B7GXH9|RL27_ACIB3 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpmA PE=3 SV=1 32 99 9.0E-09
sp|Q3ZYN4|RL27_DEHMC 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpmA PE=3 SV=1 36 115 9.0E-09
sp|A5FQ13|RL27_DEHMB 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpmA PE=3 SV=1 36 115 9.0E-09
sp|C4LJU5|RL27_CORK4 50S ribosomal protein L27 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpmA PE=3 SV=1 36 101 9.0E-09
sp|Q3YX56|RL27_SHISS 50S ribosomal protein L27 OS=Shigella sonnei (strain Ss046) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|P0A7M1|RL27_SHIFL 50S ribosomal protein L27 OS=Shigella flexneri GN=rpmA PE=3 SV=2 34 114 9.0E-09
sp|Q0T099|RL27_SHIF8 50S ribosomal protein L27 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|Q32BE8|RL27_SHIDS 50S ribosomal protein L27 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|Q31W62|RL27_SHIBS 50S ribosomal protein L27 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B2U1Z2|RL27_SHIB3 50S ribosomal protein L27 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7LR52|RL27_ESCF3 50S ribosomal protein L27 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|Q1R6F2|RL27_ECOUT 50S ribosomal protein L27 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B1LGF1|RL27_ECOSM 50S ribosomal protein L27 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B6I1Q8|RL27_ECOSE 50S ribosomal protein L27 OS=Escherichia coli (strain SE11) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7NDG9|RL27_ECOLU 50S ribosomal protein L27 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|P0A7L8|RL27_ECOLI 50S ribosomal protein L27 OS=Escherichia coli (strain K12) GN=rpmA PE=1 SV=2 34 114 9.0E-09
sp|B1IQT8|RL27_ECOLC 50S ribosomal protein L27 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|P0A7L9|RL27_ECOL6 50S ribosomal protein L27 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpmA PE=3 SV=2 34 114 9.0E-09
sp|A8A500|RL27_ECOHS 50S ribosomal protein L27 OS=Escherichia coli O9:H4 (strain HS) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B1XHG1|RL27_ECODH 50S ribosomal protein L27 OS=Escherichia coli (strain K12 / DH10B) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|C4ZSS4|RL27_ECOBW 50S ribosomal protein L27 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7M091|RL27_ECO8A 50S ribosomal protein L27 OS=Escherichia coli O8 (strain IAI1) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7N0H8|RL27_ECO81 50S ribosomal protein L27 OS=Escherichia coli O81 (strain ED1a) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7NKQ2|RL27_ECO7I 50S ribosomal protein L27 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B5YS74|RL27_ECO5E 50S ribosomal protein L27 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|P0A7M0|RL27_ECO57 50S ribosomal protein L27 OS=Escherichia coli O157:H7 GN=rpmA PE=3 SV=2 34 114 9.0E-09
sp|B7LHP5|RL27_ECO55 50S ribosomal protein L27 OS=Escherichia coli (strain 55989 / EAEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7MBV4|RL27_ECO45 50S ribosomal protein L27 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|B7UJ78|RL27_ECO27 50S ribosomal protein L27 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|A7ZS81|RL27_ECO24 50S ribosomal protein L27 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpmA PE=3 SV=1 34 114 9.0E-09
sp|A1TYY3|RL27_MARHV 50S ribosomal protein L27 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpmA PE=3 SV=1 48 115 9.0E-09
sp|Q605N3|RL27_METCA 50S ribosomal protein L27 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpmA PE=3 SV=1 34 115 1.0E-08
sp|C4Z9Z8|RL27_EUBR3 50S ribosomal protein L27 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpmA PE=3 SV=1 36 101 1.0E-08
sp|Q9ZMD8|RL27_HELPJ 50S ribosomal protein L27 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpmA PE=3 SV=1 31 109 1.0E-08
sp|Q0AAD7|RL27_ALKEH 50S ribosomal protein L27 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpmA PE=3 SV=1 34 114 1.0E-08
sp|Q3Z6W2|RL27_DEHM1 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpmA PE=3 SV=1 36 115 1.0E-08
sp|A0AIY9|RL27_LISW6 50S ribosomal protein L27 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|P66125|RL27_LISMO 50S ribosomal protein L27 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|B8DHK8|RL27_LISMH 50S ribosomal protein L27 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|Q71ZD0|RL27_LISMF 50S ribosomal protein L27 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|C1KVI7|RL27_LISMC 50S ribosomal protein L27 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|P66126|RL27_LISIN 50S ribosomal protein L27 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpmA PE=3 SV=1 34 101 1.0E-08
sp|B8GQQ2|RL27_THISH 50S ribosomal protein L27 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpmA PE=3 SV=1 34 115 1.0E-08
sp|B5YJ66|RL27_THEYD 50S ribosomal protein L27 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpmA PE=3 SV=1 36 101 1.0E-08
sp|A0ZZY9|RL27_BIFAA 50S ribosomal protein L27 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpmA PE=3 SV=1 36 99 1.0E-08
sp|B5YEQ2|RL27_DICT6 50S ribosomal protein L27 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpmA PE=3 SV=1 34 99 2.0E-08
sp|Q5KWP3|RL27_GEOKA 50S ribosomal protein L27 OS=Geobacillus kaustophilus (strain HTA426) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|A7GTC2|RL27_BACCN 50S ribosomal protein L27 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|Q97JL5|RL27_CLOAB 50S ribosomal protein L27 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpmA PE=3 SV=1 36 114 2.0E-08
sp|Q817U4|RL27_BACCR 50S ribosomal protein L27 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|B9IZ18|RL27_BACCQ 50S ribosomal protein L27 OS=Bacillus cereus (strain Q1) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|B7HQK0|RL27_BACC7 50S ribosomal protein L27 OS=Bacillus cereus (strain AH187) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|B7HE75|RL27_BACC4 50S ribosomal protein L27 OS=Bacillus cereus (strain B4264) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|Q72ZY3|RL27_BACC1 50S ribosomal protein L27 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpmA PE=3 SV=1 31 101 2.0E-08
sp|Q5R033|RL27_IDILO 50S ribosomal protein L27 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpmA PE=3 SV=1 34 115 2.0E-08
sp|C1CZK0|RL27_DEIDV 50S ribosomal protein L27 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpmA PE=3 SV=1 36 99 2.0E-08
sp|A4VI53|RL27_PSEU5 50S ribosomal protein L27 OS=Pseudomonas stutzeri (strain A1501) GN=rpmA PE=3 SV=1 34 115 3.0E-08
sp|C5D5G7|RL27_GEOSW 50S ribosomal protein L27 OS=Geobacillus sp. (strain WCH70) GN=rpmA PE=3 SV=1 31 101 3.0E-08
sp|P07844|RL27_GEOSE 50S ribosomal protein L27 OS=Geobacillus stearothermophilus GN=rpmA PE=1 SV=2 31 101 3.0E-08
sp|Q7MX94|RL27_PORGI 50S ribosomal protein L27 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpmA PE=3 SV=1 41 114 3.0E-08
sp|B2RLC1|RL27_PORG3 50S ribosomal protein L27 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpmA PE=3 SV=1 41 114 3.0E-08
sp|A1VF57|RL27_DESVV 50S ribosomal protein L27 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|Q72DK1|RL27_DESVH 50S ribosomal protein L27 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|Q1IW73|RL27_DEIGD 50S ribosomal protein L27 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpmA PE=3 SV=1 36 99 3.0E-08
sp|Q1GZ52|RL27_METFK 50S ribosomal protein L27 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|B8J4L4|RL27_DESDA 50S ribosomal protein L27 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|Q82V19|RL27_NITEU 50S ribosomal protein L27 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|B2HMG2|RL27_MYCMM 50S ribosomal protein L27 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpmA PE=3 SV=1 36 99 3.0E-08
sp|A6W353|RL27_MARMS 50S ribosomal protein L27 OS=Marinomonas sp. (strain MWYL1) GN=rpmA PE=3 SV=1 34 99 3.0E-08
sp|Q47MV5|RL27_THEFY 50S ribosomal protein L27 OS=Thermobifida fusca (strain YX) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|Q3K6K8|RL27_PSEPF 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpmA PE=3 SV=1 34 115 4.0E-08
sp|Q4K5T7|RL27_PSEF5 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpmA PE=3 SV=1 34 115 4.0E-08
sp|P9WHB3|RL27_MYCTU 50S ribosomal protein L27 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpmA PE=1 SV=1 36 99 4.0E-08
sp|P9WHB2|RL27_MYCTO 50S ribosomal protein L27 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|A5U5D7|RL27_MYCTA 50S ribosomal protein L27 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|C1AEQ8|RL27_MYCBT 50S ribosomal protein L27 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|A1KLD7|RL27_MYCBP 50S ribosomal protein L27 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|P66128|RL27_MYCBO 50S ribosomal protein L27 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpmA PE=3 SV=1 36 99 4.0E-08
sp|A4SFT3|RL27_CHLPM 50S ribosomal protein L27 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpmA PE=3 SV=1 34 99 4.0E-08
sp|A9KMF6|RL27_CLOPH 50S ribosomal protein L27 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpmA PE=3 SV=1 36 101 4.0E-08
sp|A9VIR7|RL27_BACWK 50S ribosomal protein L27 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|Q6HD83|RL27_BACHK 50S ribosomal protein L27 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|Q634A1|RL27_BACCZ 50S ribosomal protein L27 OS=Bacillus cereus (strain ZK / E33L) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|C1ETN9|RL27_BACC3 50S ribosomal protein L27 OS=Bacillus cereus (strain 03BB102) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|B7IIV4|RL27_BACC2 50S ribosomal protein L27 OS=Bacillus cereus (strain G9842) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|B7JQ28|RL27_BACC0 50S ribosomal protein L27 OS=Bacillus cereus (strain AH820) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|Q81LE8|RL27_BACAN 50S ribosomal protein L27 OS=Bacillus anthracis GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|A0RJ49|RL27_BACAH 50S ribosomal protein L27 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|C3L6X4|RL27_BACAC 50S ribosomal protein L27 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|C3P9C8|RL27_BACAA 50S ribosomal protein L27 OS=Bacillus anthracis (strain A0248) GN=rpmA PE=3 SV=1 31 101 4.0E-08
sp|A5VD71|RL27_SPHWW 50S ribosomal protein L27 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpmA PE=3 SV=1 34 114 4.0E-08
sp|A5WDV1|RL27_PSYWF 50S ribosomal protein L27 OS=Psychrobacter sp. (strain PRwf-1) GN=rpmA PE=3 SV=1 31 114 4.0E-08
sp|B0K416|RL27_THEPX 50S ribosomal protein L27 OS=Thermoanaerobacter sp. (strain X514) GN=rpmA PE=3 SV=1 36 101 5.0E-08
sp|B0KAC0|RL27_THEP3 50S ribosomal protein L27 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpmA PE=3 SV=1 36 101 5.0E-08
sp|Q836X4|RL27_ENTFA 50S ribosomal protein L27 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpmA PE=3 SV=1 34 101 5.0E-08
sp|Q9CNS7|RL27_PASMU 50S ribosomal protein L27 OS=Pasteurella multocida (strain Pm70) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|A5UI24|RL27_HAEIG 50S ribosomal protein L27 OS=Haemophilus influenzae (strain PittGG) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|A5UDJ5|RL27_HAEIE 50S ribosomal protein L27 OS=Haemophilus influenzae (strain PittEE) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|Q4QM29|RL27_HAEI8 50S ribosomal protein L27 OS=Haemophilus influenzae (strain 86-028NP) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|Q65S55|RL27_MANSM 50S ribosomal protein L27 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|A6VMT9|RL27_ACTSZ 50S ribosomal protein L27 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpmA PE=3 SV=1 32 115 5.0E-08
sp|A1WY49|RL27_HALHL 50S ribosomal protein L27 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpmA PE=3 SV=1 34 101 7.0E-08
sp|Q1Q9X2|RL27_PSYCK 50S ribosomal protein L27 OS=Psychrobacter cryohalolentis (strain K5) GN=rpmA PE=3 SV=1 31 99 7.0E-08
sp|Q4FRD8|RL27_PSYA2 50S ribosomal protein L27 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpmA PE=3 SV=1 31 99 7.0E-08
sp|Q47AD1|RL27_DECAR 50S ribosomal protein L27 OS=Dechloromonas aromatica (strain RCB) GN=rpmA PE=3 SV=1 34 99 7.0E-08
sp|A0PU16|RL27_MYCUA 50S ribosomal protein L27 OS=Mycobacterium ulcerans (strain Agy99) GN=rpmA PE=3 SV=1 36 99 8.0E-08
sp|Q7VP91|RL27_HAEDU 50S ribosomal protein L27 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpmA PE=3 SV=1 32 115 8.0E-08
sp|B0BU26|RL27_ACTPJ 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpmA PE=3 SV=1 32 115 8.0E-08
sp|B3GZE6|RL27_ACTP7 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpmA PE=3 SV=1 32 115 8.0E-08
sp|A3N3T8|RL27_ACTP2 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpmA PE=3 SV=1 32 115 8.0E-08
sp|B3EUD7|RL27_AMOA5 50S ribosomal protein L27 OS=Amoebophilus asiaticus (strain 5a2) GN=rpmA PE=3 SV=1 34 101 8.0E-08
sp|Q2S2N8|RL27_SALRD 50S ribosomal protein L27 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpmA PE=3 SV=1 31 115 8.0E-08
sp|A9BP69|RL27_DELAS 50S ribosomal protein L27 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpmA PE=3 SV=1 34 99 9.0E-08
sp|Q057J1|RL27_BUCCC 50S ribosomal protein L27 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpmA PE=3 SV=1 48 97 9.0E-08
sp|Q89ZR3|RL27_BACTN 50S ribosomal protein L27 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpmA PE=3 SV=1 41 115 9.0E-08
sp|B0UVI0|RL27_HISS2 50S ribosomal protein L27 OS=Histophilus somni (strain 2336) GN=rpmA PE=3 SV=1 32 115 1.0E-07
sp|Q0I1P7|RL27_HAES1 50S ribosomal protein L27 OS=Haemophilus somnus (strain 129Pt) GN=rpmA PE=3 SV=1 32 115 1.0E-07
sp|P44363|RL27_HAEIN 50S ribosomal protein L27 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpmA PE=3 SV=2 32 115 1.0E-07
sp|Q5FUL3|RL27_GLUOX 50S ribosomal protein L27 OS=Gluconobacter oxydans (strain 621H) GN=rpmA PE=3 SV=1 34 104 1.0E-07
sp|C1A930|RL27_GEMAT 50S ribosomal protein L27 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rpmA PE=3 SV=1 48 99 1.0E-07
sp|Q5WES5|RL27_BACSK 50S ribosomal protein L27 OS=Bacillus clausii (strain KSM-K16) GN=rpmA PE=3 SV=1 36 101 1.0E-07
sp|A7ZC11|RL27_CAMC1 50S ribosomal protein L27 OS=Campylobacter concisus (strain 13826) GN=rpmA PE=3 SV=1 31 101 1.0E-07
sp|A5UWR7|RL27_ROSS1 50S ribosomal protein L27 OS=Roseiflexus sp. (strain RS-1) GN=rpmA PE=3 SV=1 36 99 1.0E-07
sp|B8F874|RL27_HAEPS 50S ribosomal protein L27 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpmA PE=3 SV=1 32 115 1.0E-07
sp|Q8F7U1|RL27_LEPIN 50S ribosomal protein L27 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|Q72NQ6|RL27_LEPIC 50S ribosomal protein L27 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|Q054P5|RL27_LEPBL 50S ribosomal protein L27 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|Q04Q89|RL27_LEPBJ 50S ribosomal protein L27 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|B2JHD8|RL27_BURP8 50S ribosomal protein L27 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|A5GD28|RL27_GEOUR 50S ribosomal protein L27 OS=Geobacter uraniireducens (strain Rf4) GN=rpmA PE=3 SV=1 49 101 1.0E-07
sp|C4XNW1|RL27_DESMR 50S ribosomal protein L27 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpmA PE=3 SV=1 34 99 1.0E-07
sp|A4F9L2|RL27_SACEN 50S ribosomal protein L27 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpmA PE=3 SV=1 36 105 1.0E-07
sp|O78430|RK27_GUITH 50S ribosomal protein L27, chloroplastic OS=Guillardia theta GN=rpl27 PE=3 SV=1 48 101 1.0E-07
sp|A7NKS0|RL27_ROSCS 50S ribosomal protein L27 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpmA PE=3 SV=1 36 99 1.0E-07
sp|Q8REI3|RL27_FUSNN 50S ribosomal protein L27 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpmA PE=3 SV=1 31 101 1.0E-07
sp|Q6KHY5|RL27_MYCMO 50S ribosomal protein L27 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpmA PE=3 SV=1 36 99 2.0E-07
sp|C4L4N3|RL27_EXISA 50S ribosomal protein L27 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpmA PE=3 SV=1 31 101 2.0E-07
sp|Q8DUQ4|RL27_STRMU 50S ribosomal protein L27 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpmA PE=3 SV=1 34 101 2.0E-07
sp|Q0TCS5|RL27_ECOL5 50S ribosomal protein L27 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpmA PE=3 SV=1 34 114 2.0E-07
sp|C5CDI0|RL27_KOSOT 50S ribosomal protein L27 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpmA PE=3 SV=1 48 114 2.0E-07
sp|A0LPF8|RL27_SYNFM 50S ribosomal protein L27 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpmA PE=3 SV=1 34 111 2.0E-07
sp|B5RQB7|RL27_BORRA 50S ribosomal protein L27 OS=Borrelia recurrentis (strain A1) GN=rpmA PE=3 SV=1 32 115 2.0E-07
sp|B5RMX2|RL27_BORDL 50S ribosomal protein L27 OS=Borrelia duttonii (strain Ly) GN=rpmA PE=3 SV=1 32 115 2.0E-07
sp|B4RZH4|RL27_ALTMD 50S ribosomal protein L27 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpmA1 PE=3 SV=1 34 115 2.0E-07
sp|A4VUF9|RL27_STRSY 50S ribosomal protein L27 OS=Streptococcus suis (strain 05ZYH33) GN=rpmA PE=3 SV=1 37 101 2.0E-07
sp|A4W0Q0|RL27_STRS2 50S ribosomal protein L27 OS=Streptococcus suis (strain 98HAH33) GN=rpmA PE=3 SV=1 37 101 2.0E-07
sp|Q98QN2|RL27_MYCPU 50S ribosomal protein L27 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpmA PE=3 SV=1 31 114 2.0E-07
sp|A1R0K3|RL27_BORT9 50S ribosomal protein L27 OS=Borrelia turicatae (strain 91E135) GN=rpmA PE=3 SV=1 32 115 2.0E-07
sp|B8DRP0|RL27_DESVM 50S ribosomal protein L27 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpmA PE=3 SV=1 34 99 2.0E-07
sp|Q747N0|RL27_GEOSL 50S ribosomal protein L27 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpmA PE=3 SV=1 48 101 2.0E-07
sp|B4SFQ9|RL27_PELPB 50S ribosomal protein L27 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpmA PE=3 SV=1 34 99 2.0E-07
sp|O87885|RL27_LAWIN 50S ribosomal protein L27 OS=Lawsonia intracellularis GN=rpmA PE=3 SV=1 31 99 2.0E-07
sp|Q3AS97|RL27_CHLCH 50S ribosomal protein L27 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpmA PE=3 SV=1 34 99 2.0E-07
sp|O19885|RK27_CYACA 50S ribosomal protein L27, chloroplastic OS=Cyanidium caldarium GN=rpl27 PE=3 SV=1 36 99 2.0E-07
sp|A1SSB5|RL27_PSYIN 50S ribosomal protein L27 OS=Psychromonas ingrahamii (strain 37) GN=rpmA PE=3 SV=1 34 115 2.0E-07
sp|A7H030|RL27_CAMC5 50S ribosomal protein L27 OS=Campylobacter curvus (strain 525.92) GN=rpmA PE=3 SV=1 31 114 2.0E-07
sp|Q0BRF0|RL27_GRABC 50S ribosomal protein L27 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpmA PE=3 SV=1 34 104 2.0E-07
sp|Q0AWJ2|RL27_SYNWW 50S ribosomal protein L27 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpmA PE=3 SV=1 37 101 2.0E-07
sp|B1JF58|RL27_PSEPW 50S ribosomal protein L27 OS=Pseudomonas putida (strain W619) GN=rpmA PE=3 SV=1 34 115 2.0E-07
sp|Q9PQT2|RL27_UREPA 50S ribosomal protein L27 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpmA PE=3 SV=1 31 99 3.0E-07
sp|B1AIJ8|RL27_UREP2 50S ribosomal protein L27 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpmA PE=3 SV=1 31 99 3.0E-07
sp|B9DU56|RL27_STRU0 50S ribosomal protein L27 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|Q64XL7|RL27_BACFR 50S ribosomal protein L27 OS=Bacteroides fragilis (strain YCH46) GN=rpmA PE=3 SV=1 41 115 3.0E-07
sp|Q5LGR6|RL27_BACFN 50S ribosomal protein L27 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpmA PE=3 SV=1 41 115 3.0E-07
sp|Q39QR5|RL27_GEOMG 50S ribosomal protein L27 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpmA PE=3 SV=1 48 101 3.0E-07
sp|Q88WN3|RL27_LACPL 50S ribosomal protein L27 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpmA PE=3 SV=1 37 101 3.0E-07
sp|C3L3J4|RL27_CLOB6 50S ribosomal protein L27 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpmA PE=3 SV=1 36 101 3.0E-07
sp|C1CRK7|RL27_STRZT 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|C1CKH0|RL27_STRZP 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain P1031) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|C1CE94|RL27_STRZJ 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain JJA) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|B2IQ02|RL27_STRPS 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|B8ZPV1|RL27_STRPJ 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|B1IBP4|RL27_STRPI 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|C1C7A1|RL27_STRP7 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain 70585) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|B5E4L9|RL27_STRP4 50S ribosomal protein L27 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|Q04KI2|RL27_STRP2 50S ribosomal protein L27 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|A6L6D2|RL27_BACV8 50S ribosomal protein L27 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpmA PE=3 SV=1 41 99 3.0E-07
sp|B5ZB18|RL27_UREU1 50S ribosomal protein L27 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpmA PE=3 SV=1 36 99 3.0E-07
sp|B0TYK1|RL27_FRAP2 50S ribosomal protein L27 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpmA PE=3 SV=1 34 100 3.0E-07
sp|A8M0Z0|RL27_SALAI 50S ribosomal protein L27 OS=Salinispora arenicola (strain CNS-205) GN=rpmA PE=3 SV=1 37 99 3.0E-07
sp|Q72HR3|RL27_THET2 50S ribosomal protein L27 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpmA PE=1 SV=3 41 99 3.0E-07
sp|P66136|RL27_STRR6 50S ribosomal protein L27 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|P66135|RL27_STRPN 50S ribosomal protein L27 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|A6L8T0|RL27_PARD8 50S ribosomal protein L27 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpmA PE=3 SV=1 41 114 3.0E-07
sp|A8AWF9|RL27_STRGC 50S ribosomal protein L27 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpmA PE=3 SV=1 34 101 3.0E-07
sp|B5Y806|RL27_COPPD 50S ribosomal protein L27 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpmA PE=3 SV=1 37 115 3.0E-07
sp|Q74IL5|RL27_LACJO 50S ribosomal protein L27 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpmA PE=3 SV=1 37 114 3.0E-07
sp|B9M3W2|RL27_GEODF 50S ribosomal protein L27 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpmA PE=3 SV=1 49 101 3.0E-07
sp|A0Q1T6|RL27_CLONN 50S ribosomal protein L27 OS=Clostridium novyi (strain NT) GN=rpmA PE=3 SV=1 36 101 3.0E-07
sp|Q8DYV5|RL27_STRA5 50S ribosomal protein L27 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpmA PE=3 SV=1 37 101 3.0E-07
sp|Q8E4G3|RL27_STRA3 50S ribosomal protein L27 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpmA PE=3 SV=2 37 101 3.0E-07
sp|B3E330|RL27_GEOLS 50S ribosomal protein L27 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpmA PE=3 SV=1 49 101 4.0E-07
sp|Q0SR53|RL27_CLOPS 50S ribosomal protein L27 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|Q8XIJ1|RL27_CLOPE 50S ribosomal protein L27 OS=Clostridium perfringens (strain 13 / Type A) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|Q0TNI4|RL27_CLOP1 50S ribosomal protein L27 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|Q601F3|RL27_MYCH2 50S ribosomal protein L27 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpmA PE=3 SV=1 37 118 4.0E-07
sp|Q9ABB3|RL27_CAUCR 50S ribosomal protein L27 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpmA PE=3 SV=1 34 114 4.0E-07
sp|B8GYX1|RL27_CAUCN 50S ribosomal protein L27 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpmA PE=3 SV=1 34 114 4.0E-07
sp|C0QLE8|RL27_DESAH 50S ribosomal protein L27 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpmA PE=3 SV=1 32 101 4.0E-07
sp|Q03M32|RL27_STRTD 50S ribosomal protein L27 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpmA PE=3 SV=1 34 101 4.0E-07
sp|Q5M5P6|RL27_STRT2 50S ribosomal protein L27 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpmA PE=3 SV=1 34 101 4.0E-07
sp|Q5M158|RL27_STRT1 50S ribosomal protein L27 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpmA PE=3 SV=1 34 101 4.0E-07
sp|B4S9F0|RL27_PROA2 50S ribosomal protein L27 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpmA PE=3 SV=1 34 99 4.0E-07
sp|B1KZR4|RL27_CLOBM 50S ribosomal protein L27 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|A7GHK3|RL27_CLOBL 50S ribosomal protein L27 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|B1ILY6|RL27_CLOBK 50S ribosomal protein L27 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|C1FVW6|RL27_CLOBJ 50S ribosomal protein L27 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|A5I667|RL27_CLOBH 50S ribosomal protein L27 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|A7FXU7|RL27_CLOB1 50S ribosomal protein L27 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpmA PE=3 SV=1 36 101 4.0E-07
sp|B3EEE4|RL27_CHLL2 50S ribosomal protein L27 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpmA PE=3 SV=1 34 99 4.0E-07
sp|B8DVU0|RL27_BIFA0 50S ribosomal protein L27 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpmA PE=3 SV=1 36 115 5.0E-07
sp|A5N6K1|RL27_CLOK5 50S ribosomal protein L27 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpmA PE=3 SV=1 36 101 5.0E-07
sp|B9E020|RL27_CLOK1 50S ribosomal protein L27 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpmA PE=3 SV=1 36 101 5.0E-07
sp|P0DE29|RL27_STRPQ 50S ribosomal protein L27 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpmA PE=3 SV=1 34 101 5.0E-07
sp|P66139|RL27_STRP8 50S ribosomal protein L27 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpmA PE=3 SV=1 34 101 5.0E-07
sp|Q5XCS5|RL27_STRP6 50S ribosomal protein L27 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpmA PE=3 SV=2 34 101 5.0E-07
sp|P0DE28|RL27_STRP3 50S ribosomal protein L27 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpmA PE=3 SV=1 34 101 5.0E-07
sp|P66137|RL27_STRP1 50S ribosomal protein L27 OS=Streptococcus pyogenes serotype M1 GN=rpmA PE=3 SV=1 34 101 5.0E-07
sp|Q13U14|RL27_BURXL 50S ribosomal protein L27 OS=Burkholderia xenovorans (strain LB400) GN=rpmA PE=3 SV=1 34 99 5.0E-07
sp|B3QZT2|RL27_PHYMT 50S ribosomal protein L27 OS=Phytoplasma mali (strain AT) GN=rpmA PE=3 SV=1 48 99 5.0E-07
sp|A1TC22|RL27_MYCVP 50S ribosomal protein L27 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpmA PE=3 SV=1 36 115 5.0E-07
sp|Q11XX3|RL27_CYTH3 50S ribosomal protein L27 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpmA PE=3 SV=1 41 121 5.0E-07
sp|A7I2Z9|RL27_CAMHC 50S ribosomal protein L27 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpmA PE=3 SV=1 31 101 5.0E-07
sp|A4IZ44|RL27_FRATW 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpmA PE=3 SV=1 34 100 5.0E-07
sp|Q5NGR1|RL27_FRATT 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpmA PE=3 SV=1 34 100 5.0E-07
sp|A0Q5Q3|RL27_FRATN 50S ribosomal protein L27 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpmA PE=3 SV=1 34 100 5.0E-07
sp|B2SDE7|RL27_FRATM 50S ribosomal protein L27 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpmA PE=3 SV=1 34 100 5.0E-07
sp|Q14I63|RL27_FRAT1 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpmA PE=3 SV=1 34 100 5.0E-07
sp|P60493|RL27_THET8 50S ribosomal protein L27 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpmA PE=1 SV=3 48 99 6.0E-07
sp|B4U6N4|RL27_HYDS0 50S ribosomal protein L27 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpmA PE=3 SV=1 34 99 6.0E-07
sp|Q253F7|RL27_CHLFF 50S ribosomal protein L27 OS=Chlamydophila felis (strain Fe/C-56) GN=rpmA PE=3 SV=1 34 115 6.0E-07
sp|C0ME76|RL27_STRS7 50S ribosomal protein L27 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpmA PE=3 SV=1 34 101 6.0E-07
sp|B1YJS1|RL27_EXIS2 50S ribosomal protein L27 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpmA PE=3 SV=1 36 101 6.0E-07
sp|C0M7I0|RL27_STRE4 50S ribosomal protein L27 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpmA PE=3 SV=1 34 101 6.0E-07
sp|Q3B2R5|RL27_CHLL7 50S ribosomal protein L27 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpmA PE=3 SV=1 34 99 7.0E-07
sp|A1VK91|RL27_POLNA 50S ribosomal protein L27 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpmA PE=3 SV=1 34 99 7.0E-07
sp|P47476|RL27_MYCGE 50S ribosomal protein L27 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpmA PE=3 SV=1 37 99 8.0E-07
sp|B8CSY4|RL27_SHEPW 50S ribosomal protein L27 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpmA PE=3 SV=1 34 114 8.0E-07
sp|A8H0U3|RL27_SHEPA 50S ribosomal protein L27 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpmA PE=3 SV=1 34 114 8.0E-07
sp|B0TUI1|RL27_SHEHH 50S ribosomal protein L27 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpmA PE=3 SV=1 34 114 8.0E-07
sp|B0JQG5|RL27_MICAN 50S ribosomal protein L27 OS=Microcystis aeruginosa (strain NIES-843) GN=rpmA PE=3 SV=1 48 105 8.0E-07
sp|O21275|RM27_RECAM 60S ribosomal protein L27, mitochondrial OS=Reclinomonas americana GN=RPL27 PE=3 SV=1 32 105 9.0E-07
sp|B7KFE2|RL27_CYAP7 50S ribosomal protein L27 OS=Cyanothece sp. (strain PCC 7424) GN=rpmA PE=3 SV=1 36 99 9.0E-07
sp|A9L429|RL27_SHEB9 50S ribosomal protein L27 OS=Shewanella baltica (strain OS195) GN=rpmA PE=3 SV=1 34 114 9.0E-07
sp|A6WK50|RL27_SHEB8 50S ribosomal protein L27 OS=Shewanella baltica (strain OS185) GN=rpmA PE=3 SV=1 34 114 9.0E-07
sp|A3D179|RL27_SHEB5 50S ribosomal protein L27 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpmA PE=3 SV=1 34 114 9.0E-07
sp|B8EC05|RL27_SHEB2 50S ribosomal protein L27 OS=Shewanella baltica (strain OS223) GN=rpmA PE=3 SV=1 34 114 9.0E-07
sp|Q67SC7|RL27_SYMTH 50S ribosomal protein L27 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpmA PE=3 SV=1 36 115 9.0E-07
sp|P82190|RK27_SPIOL 50S ribosomal protein L27, chloroplastic (Fragment) OS=Spinacia oleracea GN=RPL27 PE=1 SV=1 36 89 9.0E-07
sp|B8I178|RL27_CLOCE 50S ribosomal protein L27 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpmA PE=3 SV=1 36 101 9.0E-07
sp|B2S1C2|RL27_BORHD 50S ribosomal protein L27 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpmA PE=3 SV=1 37 115 1.0E-06
sp|C5CXX4|RL27_VARPS 50S ribosomal protein L27 OS=Variovorax paradoxus (strain S110) GN=rpmA PE=3 SV=1 34 99 1.0E-06
sp|Q12F98|RL27_POLSJ 50S ribosomal protein L27 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpmA PE=3 SV=1 34 99 1.0E-06
sp|Q21Z00|RL27_RHOFT 50S ribosomal protein L27 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpmA PE=3 SV=1 34 99 1.0E-06
sp|Q7NZS2|RL27_CHRVO 50S ribosomal protein L27 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpmA PE=3 SV=1 34 99 1.0E-06
sp|Q32PC3|RM27_BOVIN 39S ribosomal protein L27, mitochondrial OS=Bos taurus GN=MRPL27 PE=1 SV=1 22 102 1.0E-06
sp|Q12K22|RL27_SHEDO 50S ribosomal protein L27 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpmA PE=3 SV=1 34 114 1.0E-06
sp|C5CAZ4|RL27_MICLC 50S ribosomal protein L27 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rpmA PE=3 SV=1 34 99 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5830
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1149
Ophiocordyceps australis map64 (Brazil) OphauB2|1796
Ophiocordyceps camponoti-floridani Ophcf2|03545
Ophiocordyceps camponoti-rufipedis Ophun1|1864 (this protein)
Ophiocordyceps kimflemingae Ophio5|747

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1864
MSFLLCIRRPLLRAVGGPWIAQAAATGRRQASVKAQGAYKKKNKRCAPKKLGAKKTGDQYVIPGNILWKQRGTIW
WPGENCFMGRDHTIHAKEAGYVKFYRDPERHPDRKYIGVVFKREDKLPYPRNAERKRRLGMTERPRRTEPLPKEK
LHPSGIPYEIVRKPLNEPEKLLRLRSDYSYREDNWRIGRLVKTTGIRPGRFRTRKQSYRYRRWIREKAAVGMRKT
GFKTREKAVPVKKNVSAKAAKRAAKQMKRDQQGRISKEQKRAKMLARLAMKDKKKELNM*
Coding >Ophun1|1864
ATGTCGTTTCTGCTTTGCATCCGGCGGCCGCTGCTCCGGGCTGTGGGCGGGCCGTGGATTGCGCAGGCGGCGGCG
ACGGGGCGACGACAGGCGTCCGTCAAGGCGCAGGGAGCGTACAAGAAGAAGAACAAGAGGTGTGCTCCGAAGAAG
CTGGGAGCTAAGAAGACGGGCGATCAATACGTGATTCCCGGAAATATCCTCTGGAAGCAGCGCGGTACGATTTGG
TGGCCGGGTGAGAACTGCTTCATGGGACGTGACCACACGATCCACGCCAAGGAAGCCGGCTACGTCAAGTTCTAC
CGCGACCCGGAACGACATCCAGACCGCAAATACATCGGCGTCGTCTTCAAACGCGAAGACAAGCTCCCCTACCCC
CGAAACGCCGAGCGGAAGCGTCGCCTGGGAATGACGGAGAGGCCGCGCCGGACGGAGCCGCTACCAAAGGAGAAG
CTCCATCCGTCGGGAATCCCCTACGAAATCGTGCGAAAGCCGCTCAATGAGCCGGAGAAGCTGCTCCGACTGCGT
TCCGATTACAGCTACCGCGAAGATAACTGGCGTATCGGGCGGCTGGTCAAGACGACGGGGATACGTCCCGGGCGG
TTTCGTACCCGGAAGCAGAGCTATCGCTATCGACGGTGGATTAGGGAGAAGGCTGCGGTTGGGATGCGCAAGACT
GGGTTTAAGACGAGGGAGAAGGCTGTTCCGGTTAAGAAGAATGTTAGTGCCAAGGCGGCCAAGAGGGCGGCCAAG
CAGATGAAGCGGGATCAGCAGGGGAGGATTTCGAAGGAACAGAAGAGGGCGAAGATGTTGGCGAGGTTGGCGATG
AAAGATAAGAAGAAGGAACTCAACATGTGA
Transcript >Ophun1|1864
ATGTCGTTTCTGCTTTGCATCCGGCGGCCGCTGCTCCGGGCTGTGGGCGGGCCGTGGATTGCGCAGGCGGCGGCG
ACGGGGCGACGACAGGCGTCCGTCAAGGCGCAGGGAGCGTACAAGAAGAAGAACAAGAGGTGTGCTCCGAAGAAG
CTGGGAGCTAAGAAGACGGGCGATCAATACGTGATTCCCGGAAATATCCTCTGGAAGCAGCGCGGTACGATTTGG
TGGCCGGGTGAGAACTGCTTCATGGGACGTGACCACACGATCCACGCCAAGGAAGCCGGCTACGTCAAGTTCTAC
CGCGACCCGGAACGACATCCAGACCGCAAATACATCGGCGTCGTCTTCAAACGCGAAGACAAGCTCCCCTACCCC
CGAAACGCCGAGCGGAAGCGTCGCCTGGGAATGACGGAGAGGCCGCGCCGGACGGAGCCGCTACCAAAGGAGAAG
CTCCATCCGTCGGGAATCCCCTACGAAATCGTGCGAAAGCCGCTCAATGAGCCGGAGAAGCTGCTCCGACTGCGT
TCCGATTACAGCTACCGCGAAGATAACTGGCGTATCGGGCGGCTGGTCAAGACGACGGGGATACGTCCCGGGCGG
TTTCGTACCCGGAAGCAGAGCTATCGCTATCGACGGTGGATTAGGGAGAAGGCTGCGGTTGGGATGCGCAAGACT
GGGTTTAAGACGAGGGAGAAGGCTGTTCCGGTTAAGAAGAATGTTAGTGCCAAGGCGGCCAAGAGGGCGGCCAAG
CAGATGAAGCGGGATCAGCAGGGGAGGATTTCGAAGGAACAGAAGAGGGCGAAGATGTTGGCGAGGTTGGCGATG
AAAGATAAGAAGAAGGAACTCAACATGTGA
Gene >Ophun1|1864
ATGTCGTTTCTGCTTTGCATCCGGCGGCCGCTGCTCCGGGCTGTGGGCGGGCCGTGGATTGCGCAGGCGGCGGCG
ACGGGGCGACGACAGGCGTCCGTCAAGGCGCAGGGAGCGTACAAGAAGAAGAACAAGAGGTGTGCTCCGAAGAAG
CTGGGAGCTAAGAAGACGGGCGGTAAGAAGTTCAGAAAGCTCAGACAATGATGGAAGGAAGGCTGACGAGATGAT
TGACCACAGATCAATACGTGATTCCCGGAAATATCCTCTGGAAGCAGCGCGGTACGATTTGGTGGCCGGGTGAGA
ACTGCTTCATGGGACGTGACCACACGATCCACGCCAAGGAAGCCGGCTACGTCAAGTTCTACCGCGACCCGGAAC
GACATCCAGACCGCAAATACATCGGCGTCGTCTTCAAACGCGAAGACAAGCTCCCCTACCCCCGAAACGCCGAGC
GGAAGCGTCGCCTGGGAATGACGGAGAGGCCGCGCCGGACGGAGCCGCTACCAAAGGAGAAGCTCCATCCGTCGG
GAATCCCCTACGAAATCGTGCGAAAGCCGCTCAATGAGCCGGAGAAGCTGCTCCGACTGCGTTCCGATTACAGCT
ACCGCGAAGATAACTGGCGTATCGGGCGGCTGGTCAAGACGACGGGGATACGTCCCGGGCGGTTTCGTACCCGGA
AGCAGAGCTATCGCTATCGACGGTGGATTAGGGAGAAGGCTGCGGTTGGGATGCGCAAGACTGGGTTTAAGACGA
GGGAGAAGGCTGTTCCGGTTAAGAAGAATGTTAGTGCCAAGGCGGCCAAGAGGGCGGCCAAGCAGATGAAGCGGG
ATCAGCAGGGGAGGATTTCGAAGGAACAGAAGAGGGCGAAGATGTTGGCGAGGTTGGCGATGAAAGATAAGAAGA
AGGAACTCAACATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail