Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1862
Gene name
LocationContig_182:18030..19598
Strand+
Gene length (bp)1568
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01715 IPPT IPP transferase 4.8E-67 84 361
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 3.8E-05 442 465
PF12874 zf-met Zinc-finger of C2H2 type 6.1E-04 441 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT75|MOD5_SCHPO tRNA dimethylallyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tit1 PE=3 SV=1 49 472 2.0E-84
sp|Q80UN9|MOD5_MOUSE tRNA dimethylallyltransferase, mitochondrial OS=Mus musculus GN=Trit1 PE=2 SV=2 48 492 3.0E-80
sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1 38 492 3.0E-80
sp|P07884|MOD5_YEAST tRNA dimethylallyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOD5 PE=1 SV=2 48 470 1.0E-71
sp|B9M3M9|MIAA2_GEODF tRNA dimethylallyltransferase 2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=miaA2 PE=3 SV=1 44 362 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT75|MOD5_SCHPO tRNA dimethylallyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tit1 PE=3 SV=1 49 472 2.0E-84
sp|Q80UN9|MOD5_MOUSE tRNA dimethylallyltransferase, mitochondrial OS=Mus musculus GN=Trit1 PE=2 SV=2 48 492 3.0E-80
sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1 38 492 3.0E-80
sp|P07884|MOD5_YEAST tRNA dimethylallyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOD5 PE=1 SV=2 48 470 1.0E-71
sp|B9M3M9|MIAA2_GEODF tRNA dimethylallyltransferase 2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=miaA2 PE=3 SV=1 44 362 3.0E-47
sp|A0Q0M8|MIAA_CLONN tRNA dimethylallyltransferase OS=Clostridium novyi (strain NT) GN=miaA PE=3 SV=1 49 361 1.0E-46
sp|Q9ZUX7|IPT2_ARATH tRNA dimethylallyltransferase 2 OS=Arabidopsis thaliana GN=IPT2 PE=1 SV=2 54 466 1.0E-45
sp|Q5WFY6|MIAA_BACSK tRNA dimethylallyltransferase OS=Bacillus clausii (strain KSM-K16) GN=miaA PE=3 SV=1 49 361 1.0E-44
sp|B7GIA2|MIAA_ANOFW tRNA dimethylallyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=miaA PE=3 SV=1 49 361 2.0E-44
sp|A5D2K7|MIAA_PELTS tRNA dimethylallyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=miaA PE=3 SV=1 49 369 1.0E-43
sp|Q39TZ3|MIAA_GEOMG tRNA dimethylallyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=miaA PE=3 SV=1 51 361 7.0E-43
sp|A4IMI5|MIAA_GEOTN tRNA dimethylallyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=miaA PE=3 SV=1 48 361 1.0E-42
sp|Q8R5S5|MIAA_CALS4 tRNA dimethylallyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=miaA PE=3 SV=1 51 361 2.0E-42
sp|Q8CXG5|MIAA_OCEIH tRNA dimethylallyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=miaA PE=3 SV=1 49 363 2.0E-42
sp|B5EGD5|MIAA1_GEOBB tRNA dimethylallyltransferase 1 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=miaA1 PE=3 SV=1 51 360 2.0E-42
sp|Q74BP1|MIAA_GEOSL tRNA dimethylallyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=miaA PE=3 SV=1 51 361 3.0E-42
sp|B9MJT8|MIAA_CALBD tRNA dimethylallyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=miaA PE=3 SV=1 50 363 5.0E-42
sp|A3DDI1|MIAA_CLOTH tRNA dimethylallyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=miaA PE=3 SV=1 49 361 2.0E-41
sp|A4XL45|MIAA_CALS8 tRNA dimethylallyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=miaA PE=3 SV=1 50 363 5.0E-41
sp|Q5L0D9|MIAA_GEOKA tRNA dimethylallyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=miaA PE=3 SV=1 48 361 5.0E-41
sp|A5GEV6|MIAA2_GEOUR tRNA dimethylallyltransferase 2 OS=Geobacter uraniireducens (strain Rf4) GN=miaA2 PE=3 SV=1 51 360 5.0E-41
sp|B9DPA1|MIAA_STACT tRNA dimethylallyltransferase OS=Staphylococcus carnosus (strain TM300) GN=miaA PE=3 SV=1 51 363 2.0E-40
sp|Q49X96|MIAA_STAS1 tRNA dimethylallyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=miaA PE=3 SV=1 49 363 3.0E-40
sp|A1AT90|MIAA1_PELPD tRNA dimethylallyltransferase 1 OS=Pelobacter propionicus (strain DSM 2379) GN=miaA1 PE=3 SV=1 45 360 4.0E-40
sp|Q8CQL3|MIAA_STAES tRNA dimethylallyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=miaA PE=1 SV=1 48 363 5.0E-40
sp|Q5HPN8|MIAA_STAEQ tRNA dimethylallyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=miaA PE=3 SV=1 48 363 5.0E-40
sp|C1FNT7|MIAA_CLOBJ tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=miaA PE=3 SV=1 51 361 5.0E-40
sp|Q820U0|MIAA_ENTFA tRNA dimethylallyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=miaA PE=3 SV=1 49 361 6.0E-40
sp|Q3ACA8|MIAA_CARHZ tRNA dimethylallyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=miaA PE=3 SV=1 48 361 6.0E-40
sp|Q4L610|MIAA_STAHJ tRNA dimethylallyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=miaA PE=3 SV=1 51 363 7.0E-40
sp|B0K1A4|MIAA_THEPX tRNA dimethylallyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=miaA PE=3 SV=1 51 361 7.0E-40
sp|B0K9L7|MIAA_THEP3 tRNA dimethylallyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=miaA PE=3 SV=1 51 361 7.0E-40
sp|Q733B9|MIAA_BACC1 tRNA dimethylallyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=miaA PE=3 SV=1 49 363 1.0E-39
sp|Q187T5|MIAA_PEPD6 tRNA dimethylallyltransferase OS=Peptoclostridium difficile (strain 630) GN=miaA PE=3 SV=2 50 361 1.0E-39
sp|A9KL08|MIAA_CLOPH tRNA dimethylallyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=miaA PE=3 SV=1 49 364 2.0E-39
sp|B1KSA1|MIAA_CLOBM tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=miaA PE=3 SV=1 51 361 2.0E-39
sp|B1HRH3|MIAA_LYSSC tRNA dimethylallyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=miaA PE=3 SV=1 51 363 2.0E-39
sp|C3KX33|MIAA_CLOB6 tRNA dimethylallyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=miaA PE=3 SV=1 51 361 2.0E-39
sp|O31795|MIAA_BACSU tRNA dimethylallyltransferase OS=Bacillus subtilis (strain 168) GN=miaA PE=3 SV=2 49 363 3.0E-39
sp|A9A0U3|MIAA_DESOH tRNA dimethylallyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=miaA PE=3 SV=1 47 361 3.0E-39
sp|B7HKR9|MIAA_BACC7 tRNA dimethylallyltransferase OS=Bacillus cereus (strain AH187) GN=miaA PE=3 SV=1 49 363 4.0E-39
sp|B9IUM7|MIAA_BACCQ tRNA dimethylallyltransferase OS=Bacillus cereus (strain Q1) GN=miaA PE=3 SV=1 49 363 4.0E-39
sp|B1IM66|MIAA_CLOBK tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=miaA PE=3 SV=1 51 361 4.0E-39
sp|A7GR71|MIAA_BACCN tRNA dimethylallyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=miaA PE=3 SV=1 49 363 4.0E-39
sp|B7ISQ9|MIAA_BACC2 tRNA dimethylallyltransferase OS=Bacillus cereus (strain G9842) GN=miaA PE=3 SV=1 49 363 5.0E-39
sp|A7Z500|MIAA_BACMF tRNA dimethylallyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=miaA PE=3 SV=1 49 363 7.0E-39
sp|A5I2S0|MIAA_CLOBH tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=miaA PE=3 SV=1 51 361 9.0E-39
sp|A7FUK8|MIAA_CLOB1 tRNA dimethylallyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=miaA PE=3 SV=1 51 361 9.0E-39
sp|Q81JG8|MIAA_BACAN tRNA dimethylallyltransferase OS=Bacillus anthracis GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|B7HCI3|MIAA_BACC4 tRNA dimethylallyltransferase OS=Bacillus cereus (strain B4264) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|B8DG34|MIAA_LISMH tRNA dimethylallyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=miaA PE=3 SV=1 50 361 1.0E-38
sp|B8CX96|MIAA_HALOH tRNA dimethylallyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=miaA PE=3 SV=1 46 364 1.0E-38
sp|Q812Y4|MIAA_BACCR tRNA dimethylallyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|Q6HF97|MIAA_BACHK tRNA dimethylallyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|Q636W2|MIAA_BACCZ tRNA dimethylallyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|C1ENE7|MIAA_BACC3 tRNA dimethylallyltransferase OS=Bacillus cereus (strain 03BB102) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|C3L886|MIAA_BACAC tRNA dimethylallyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|C3P4Y4|MIAA_BACAA tRNA dimethylallyltransferase OS=Bacillus anthracis (strain A0248) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|A0RH88|MIAA_BACAH tRNA dimethylallyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=miaA PE=3 SV=1 49 363 1.0E-38
sp|A7GE43|MIAA_CLOBL tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=miaA PE=3 SV=1 51 361 2.0E-38
sp|B2VAE4|MIAA_SULSY tRNA dimethylallyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=miaA PE=3 SV=1 51 363 2.0E-38
sp|Q0STR2|MIAA_CLOPS tRNA dimethylallyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=miaA PE=3 SV=1 51 361 2.0E-38
sp|B7JIE1|MIAA_BACC0 tRNA dimethylallyltransferase OS=Bacillus cereus (strain AH820) GN=miaA PE=3 SV=1 49 363 2.0E-38
sp|A0AI95|MIAA_LISW6 tRNA dimethylallyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=miaA PE=3 SV=1 50 361 3.0E-38
sp|B2GKG9|MIAA_KOCRD tRNA dimethylallyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=miaA PE=3 SV=1 38 360 3.0E-38
sp|Q1G9D6|MIAA_LACDA tRNA dimethylallyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=miaA PE=3 SV=1 49 363 4.0E-38
sp|Q6GHD2|MIAA_STAAR tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=miaA PE=3 SV=1 51 363 4.0E-38
sp|A1SNF6|MIAA_NOCSJ tRNA dimethylallyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=miaA PE=3 SV=1 45 361 6.0E-38
sp|B2V267|MIAA_CLOBA tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=miaA PE=3 SV=1 49 361 7.0E-38
sp|B8HG92|MIAA_ARTCA tRNA dimethylallyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=miaA PE=3 SV=1 48 361 8.0E-38
sp|P65356|MIAA_STAAW tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain MW2) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|A8Z1X3|MIAA_STAAT tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|P65355|MIAA_STAAN tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain N315) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|P65354|MIAA_STAAM tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|A6QGK1|MIAA_STAAE tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain Newman) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|Q5HGC9|MIAA_STAAC tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain COL) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|A5ISI5|MIAA_STAA9 tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain JH9) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|Q2FYZ2|MIAA_STAA8 tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|Q2FHD6|MIAA_STAA3 tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain USA300) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|A6U1C1|MIAA_STAA2 tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain JH1) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|A7X1U8|MIAA_STAA1 tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=miaA PE=3 SV=1 51 363 8.0E-38
sp|B2TIB7|MIAA_CLOBB tRNA dimethylallyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=miaA PE=3 SV=1 49 361 9.0E-38
sp|A0LJK3|MIAA_SYNFM tRNA dimethylallyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=miaA PE=3 SV=1 20 361 1.0E-37
sp|Q049I6|MIAA_LACDB tRNA dimethylallyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=miaA PE=3 SV=1 49 363 1.0E-37
sp|Q5FJ02|MIAA_LACAC tRNA dimethylallyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=miaA PE=3 SV=1 49 361 1.0E-37
sp|B0TB07|MIAA_HELMI tRNA dimethylallyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=miaA PE=3 SV=1 52 361 2.0E-37
sp|Q0TRD4|MIAA_CLOP1 tRNA dimethylallyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=miaA PE=3 SV=1 51 361 2.0E-37
sp|A9VR03|MIAA_BACWK tRNA dimethylallyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=miaA PE=3 SV=1 49 363 2.0E-37
sp|Q92C59|MIAA_LISIN tRNA dimethylallyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=miaA PE=3 SV=1 50 361 2.0E-37
sp|B9L505|MIAA_THERP tRNA dimethylallyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=miaA PE=3 SV=1 49 361 3.0E-37
sp|Q9KAC3|MIAA_BACHD tRNA dimethylallyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=miaA PE=1 SV=1 49 363 4.0E-37
sp|A6LWJ0|MIAA_CLOB8 tRNA dimethylallyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=miaA PE=3 SV=1 49 392 4.0E-37
sp|Q8XL85|MIAA_CLOPE tRNA dimethylallyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=miaA PE=3 SV=1 51 361 4.0E-37
sp|C4L1B9|MIAA_EXISA tRNA dimethylallyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=miaA PE=3 SV=1 50 367 5.0E-37
sp|A8FDI9|MIAA_BACP2 tRNA dimethylallyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=miaA PE=3 SV=2 49 363 5.0E-37
sp|Q029I5|MIAA_SOLUE tRNA dimethylallyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=miaA PE=3 SV=1 50 361 6.0E-37
sp|A1R551|MIAA_ARTAT tRNA dimethylallyltransferase OS=Arthrobacter aurescens (strain TC1) GN=miaA PE=3 SV=1 44 361 6.0E-37
sp|Q6G9R0|MIAA_STAAS tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=miaA PE=3 SV=1 51 363 7.0E-37
sp|Q2YXR3|MIAA_STAAB tRNA dimethylallyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=miaA PE=3 SV=2 51 363 8.0E-37
sp|Q2K6H4|MIAA_RHIEC tRNA dimethylallyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=miaA PE=3 SV=1 48 370 1.0E-36
sp|O67162|MIAA_AQUAE tRNA dimethylallyltransferase OS=Aquifex aeolicus (strain VF5) GN=miaA PE=3 SV=1 51 361 1.0E-36
sp|B1YMH0|MIAA_EXIS2 tRNA dimethylallyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=miaA PE=3 SV=1 45 371 2.0E-36
sp|B2A3X9|MIAA_NATTJ tRNA dimethylallyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=miaA PE=3 SV=1 48 361 2.0E-36
sp|Q2RJG0|MIAA_MOOTA tRNA dimethylallyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=miaA PE=3 SV=1 49 361 3.0E-36
sp|Q03G75|MIAA_PEDPA tRNA dimethylallyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=miaA PE=3 SV=1 49 363 3.0E-36
sp|Q97I21|MIAA_CLOAB tRNA dimethylallyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=miaA PE=3 SV=1 49 361 3.0E-36
sp|Q24X66|MIAA_DESHY tRNA dimethylallyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=miaA PE=3 SV=1 49 361 3.0E-36
sp|A8F5B3|MIAA_PSELT tRNA dimethylallyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=miaA PE=3 SV=1 51 361 3.0E-36
sp|A0JUY7|MIAA_ARTS2 tRNA dimethylallyltransferase OS=Arthrobacter sp. (strain FB24) GN=miaA PE=3 SV=1 31 361 4.0E-36
sp|B9EBJ1|MIAA_MACCJ tRNA dimethylallyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=miaA PE=3 SV=1 50 361 7.0E-36
sp|A8MFD2|MIAA_ALKOO tRNA dimethylallyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=miaA PE=3 SV=1 51 361 7.0E-36
sp|Q38W03|MIAA_LACSS tRNA dimethylallyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=miaA PE=3 SV=1 49 391 2.0E-35
sp|Q720C8|MIAA_LISMF tRNA dimethylallyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=miaA PE=3 SV=1 50 361 2.0E-35
sp|C1L2K1|MIAA_LISMC tRNA dimethylallyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=miaA PE=3 SV=1 50 361 2.0E-35
sp|A9WQ48|MIAA_RENSM tRNA dimethylallyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=miaA PE=3 SV=1 39 360 2.0E-35
sp|B8FWE4|MIAA_DESHD tRNA dimethylallyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=miaA PE=3 SV=1 49 361 2.0E-35
sp|B8FNN5|MIAA_DESAA tRNA dimethylallyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=miaA PE=3 SV=1 46 379 3.0E-35
sp|B0S1C3|MIAA_FINM2 tRNA dimethylallyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=miaA PE=3 SV=1 52 369 3.0E-35
sp|A8YWA5|MIAA_LACH4 tRNA dimethylallyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=miaA PE=3 SV=1 49 361 4.0E-35
sp|Q1ME89|MIAA_RHIL3 tRNA dimethylallyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=miaA PE=3 SV=1 52 361 4.0E-35
sp|Q8Y7I3|MIAA_LISMO tRNA dimethylallyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=miaA PE=3 SV=1 50 361 5.0E-35
sp|Q041Y0|MIAA_LACGA tRNA dimethylallyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=miaA PE=3 SV=1 49 361 6.0E-35
sp|B4U6P0|MIAA_HYDS0 tRNA dimethylallyltransferase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=miaA PE=3 SV=1 52 361 7.0E-35
sp|B5YE43|MIAA_DICT6 tRNA dimethylallyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=miaA PE=3 SV=1 50 361 8.0E-35
sp|Q67NL1|MIAA_SYMTH tRNA dimethylallyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=miaA PE=3 SV=1 50 375 1.0E-34
sp|Q92NR2|MIAA_RHIME tRNA dimethylallyltransferase OS=Rhizobium meliloti (strain 1021) GN=miaA PE=3 SV=1 52 361 1.0E-34
sp|Q895H4|MIAA_CLOTE tRNA dimethylallyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=miaA PE=3 SV=1 51 361 2.0E-34
sp|A6TR77|MIAA_ALKMQ tRNA dimethylallyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=miaA PE=3 SV=1 49 366 2.0E-34
sp|Q1WUH1|MIAA_LACS1 tRNA dimethylallyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=miaA PE=3 SV=1 48 363 3.0E-34
sp|Q2S2F9|MIAA_SALRD tRNA dimethylallyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=miaA PE=3 SV=1 48 361 3.0E-34
sp|Q3SIR0|MIAA_THIDA tRNA dimethylallyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=miaA PE=3 SV=1 50 361 4.0E-34
sp|Q8DT87|MIAA_STRMU tRNA dimethylallyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=miaA PE=3 SV=1 50 361 5.0E-34
sp|Q74IF3|MIAA_LACJO tRNA dimethylallyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=miaA PE=3 SV=1 49 361 6.0E-34
sp|A5N8I7|MIAA_CLOK5 tRNA dimethylallyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=miaA PE=3 SV=1 49 361 6.0E-34
sp|B9E1Z2|MIAA_CLOK1 tRNA dimethylallyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=miaA PE=3 SV=1 49 361 6.0E-34
sp|Q0AYB0|MIAA_SYNWW tRNA dimethylallyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=miaA PE=3 SV=1 50 364 1.0E-33
sp|B1MXL9|MIAA_LEUCK tRNA dimethylallyltransferase OS=Leuconostoc citreum (strain KM20) GN=miaA PE=3 SV=1 51 379 1.0E-33
sp|Q6MBT2|MIAA_PARUW tRNA dimethylallyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=miaA PE=3 SV=1 51 361 2.0E-33
sp|Q65JA9|MIAA_BACLD tRNA dimethylallyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=miaA PE=3 SV=1 50 361 2.0E-33
sp|A6LMU4|MIAA_THEM4 tRNA dimethylallyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=miaA PE=3 SV=1 53 361 2.0E-33
sp|Q03RP7|MIAA_LACBA tRNA dimethylallyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=miaA PE=3 SV=1 51 361 2.0E-33
sp|Q92HW4|MIAA_RICCN tRNA dimethylallyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=miaA PE=3 SV=3 44 361 2.0E-33
sp|B3E5Z1|MIAA1_GEOLS tRNA dimethylallyltransferase 1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=miaA1 PE=3 SV=1 51 361 2.0E-33
sp|Q607R4|MIAA_METCA tRNA dimethylallyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=miaA PE=3 SV=1 50 361 4.0E-33
sp|A8F1N7|MIAA_RICM5 tRNA dimethylallyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=miaA PE=3 SV=1 44 361 5.0E-33
sp|A7HJQ9|MIAA_FERNB tRNA dimethylallyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=miaA PE=3 SV=1 52 361 6.0E-33
sp|B5ZVU9|MIAA_RHILW tRNA dimethylallyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=miaA PE=3 SV=1 52 361 6.0E-33
sp|A8GS87|MIAA_RICRS tRNA dimethylallyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=miaA PE=3 SV=1 44 361 8.0E-33
sp|B0BXQ1|MIAA_RICRO tRNA dimethylallyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=miaA PE=3 SV=1 44 361 8.0E-33
sp|B9LI82|MIAA_CHLSY tRNA dimethylallyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=miaA PE=3 SV=1 49 361 8.0E-33
sp|A9WDJ6|MIAA_CHLAA tRNA dimethylallyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=miaA PE=3 SV=1 49 361 8.0E-33
sp|A0LUZ6|MIAA_ACIC1 tRNA dimethylallyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=miaA PE=3 SV=1 51 361 1.0E-32
sp|A4G288|MIAA_HERAR tRNA dimethylallyltransferase OS=Herminiimonas arsenicoxydans GN=miaA PE=3 SV=1 45 379 1.0E-32
sp|B3PTP8|MIAA_RHIE6 tRNA dimethylallyltransferase OS=Rhizobium etli (strain CIAT 652) GN=miaA PE=3 SV=1 48 361 1.0E-32
sp|Q2LUR0|MIAA2_SYNAS tRNA dimethylallyltransferase 2 OS=Syntrophus aciditrophicus (strain SB) GN=miaA2 PE=3 SV=1 51 362 1.0E-32
sp|B1I295|MIAA_DESAP tRNA dimethylallyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=miaA PE=3 SV=1 46 361 2.0E-32
sp|A6UB14|MIAA_SINMW tRNA dimethylallyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=miaA PE=3 SV=1 52 361 3.0E-32
sp|Q9CHU2|MIAA_LACLA tRNA dimethylallyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=miaA PE=3 SV=1 48 380 5.0E-32
sp|A4W2A2|MIAA_STRS2 tRNA dimethylallyltransferase OS=Streptococcus suis (strain 98HAH33) GN=miaA PE=3 SV=1 50 361 5.0E-32
sp|B8E281|MIAA_DICTD tRNA dimethylallyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=miaA PE=3 SV=1 50 361 5.0E-32
sp|B2UBL0|MIAA_RALPJ tRNA dimethylallyltransferase OS=Ralstonia pickettii (strain 12J) GN=miaA PE=3 SV=1 52 361 7.0E-32
sp|A4VVZ3|MIAA_STRSY tRNA dimethylallyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=miaA PE=3 SV=1 50 361 8.0E-32
sp|Q3ZXC6|MIAA_DEHMC tRNA dimethylallyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=miaA PE=3 SV=1 39 372 8.0E-32
sp|A5FRB5|MIAA_DEHMB tRNA dimethylallyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=miaA PE=3 SV=1 39 372 9.0E-32
sp|A9BHW9|MIAA_PETMO tRNA dimethylallyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=miaA PE=3 SV=1 50 361 9.0E-32
sp|B7IDS3|MIAA_THEAB tRNA dimethylallyltransferase OS=Thermosipho africanus (strain TCF52B) GN=miaA PE=3 SV=1 53 366 1.0E-31
sp|B9JGK2|MIAA_AGRRK tRNA dimethylallyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=miaA PE=3 SV=2 52 361 1.0E-31
sp|A2SHF3|MIAA_METPP tRNA dimethylallyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=miaA PE=3 SV=1 52 386 1.0E-31
sp|Q8CX09|MIAA_STRA5 tRNA dimethylallyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=miaA PE=3 SV=1 50 361 2.0E-31
sp|Q5GYM0|MIAA_XANOR tRNA dimethylallyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=miaA PE=3 SV=2 52 371 2.0E-31
sp|B2SUC1|MIAA_XANOP tRNA dimethylallyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=miaA PE=3 SV=1 52 371 2.0E-31
sp|Q8PLQ5|MIAA_XANAC tRNA dimethylallyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=miaA PE=3 SV=1 52 383 2.0E-31
sp|Q8XWB0|MIAA_RALSO tRNA dimethylallyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=miaA PE=3 SV=1 45 368 3.0E-31
sp|Q3Z8H3|MIAA_DEHM1 tRNA dimethylallyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=miaA PE=3 SV=1 35 361 3.0E-31
sp|Q4JV82|MIAA_CORJK tRNA dimethylallyltransferase OS=Corynebacterium jeikeium (strain K411) GN=miaA PE=3 SV=1 52 361 4.0E-31
sp|A6SV54|MIAA_JANMA tRNA dimethylallyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=miaA PE=3 SV=1 48 361 4.0E-31
sp|A5UYJ2|MIAA_ROSS1 tRNA dimethylallyltransferase OS=Roseiflexus sp. (strain RS-1) GN=miaA PE=3 SV=1 50 361 5.0E-31
sp|B8G9R5|MIAA_CHLAD tRNA dimethylallyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=miaA PE=3 SV=1 51 361 5.0E-31
sp|A4SZQ9|MIAA_POLSQ tRNA dimethylallyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=miaA PE=3 SV=1 44 361 5.0E-31
sp|Q0S1N9|MIAA_RHOJR tRNA dimethylallyltransferase OS=Rhodococcus jostii (strain RHA1) GN=miaA PE=3 SV=1 48 389 6.0E-31
sp|A7NRZ0|MIAA_ROSCS tRNA dimethylallyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=miaA PE=3 SV=1 50 361 6.0E-31
sp|Q8E4V8|MIAA_STRA3 tRNA dimethylallyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=miaA PE=3 SV=1 50 361 7.0E-31
sp|B4RGS2|MIAA_PHEZH tRNA dimethylallyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=miaA PE=3 SV=1 49 372 8.0E-31
sp|P0A3Q6|MIAA_RHIRD tRNA dimethylallyltransferase OS=Rhizobium radiobacter GN=miaA PE=3 SV=1 52 361 8.0E-31
sp|P0A3Q5|MIAA_AGRFC tRNA dimethylallyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=miaA PE=3 SV=1 52 361 8.0E-31
sp|Q2P1M3|MIAA_XANOM tRNA dimethylallyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=miaA PE=3 SV=1 52 361 8.0E-31
sp|Q3K0P1|MIAA_STRA1 tRNA dimethylallyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=miaA PE=3 SV=1 50 361 1.0E-30
sp|A8GNL2|MIAA_RICAH tRNA dimethylallyltransferase OS=Rickettsia akari (strain Hartford) GN=miaA PE=3 SV=1 48 361 2.0E-30
sp|Q7U372|MIAA_BORPA tRNA dimethylallyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=miaA PE=3 SV=1 51 361 2.0E-30
sp|Q7U366|MIAA_BORPE tRNA dimethylallyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=miaA PE=3 SV=1 51 361 2.0E-30
sp|Q7U383|MIAA_BORBR tRNA dimethylallyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=miaA PE=3 SV=1 51 361 2.0E-30
sp|A5IJP9|MIAA_THEP1 tRNA dimethylallyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=miaA PE=3 SV=1 53 364 2.0E-30
sp|A9I7X7|MIAA_BORPD tRNA dimethylallyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=miaA PE=3 SV=1 50 361 2.0E-30
sp|Q6ALW6|MIAA_DESPS tRNA dimethylallyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=miaA PE=3 SV=1 49 360 2.0E-30
sp|Q3J802|MIAA_NITOC tRNA dimethylallyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=miaA PE=3 SV=1 50 361 2.0E-30
sp|A5CSL4|MIAA_CLAM3 tRNA dimethylallyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=miaA PE=3 SV=1 50 368 3.0E-30
sp|B3ES47|MIAA_AMOA5 tRNA dimethylallyltransferase OS=Amoebophilus asiaticus (strain 5a2) GN=miaA PE=3 SV=1 43 362 3.0E-30
sp|A3CNS2|MIAA_STRSV tRNA dimethylallyltransferase OS=Streptococcus sanguinis (strain SK36) GN=miaA PE=3 SV=1 51 361 3.0E-30
sp|B9KBC5|MIAA_THENN tRNA dimethylallyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=miaA PE=3 SV=1 51 361 4.0E-30
sp|Q5M430|MIAA_STRT2 tRNA dimethylallyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=miaA PE=3 SV=2 51 361 4.0E-30
sp|Q3BUR5|MIAA_XANC5 tRNA dimethylallyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=miaA PE=3 SV=1 52 383 4.0E-30
sp|Q1J708|MIAA_STRPF tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=miaA PE=3 SV=1 50 361 4.0E-30
sp|Q7MAW8|MIAA1_PORGI tRNA dimethylallyltransferase 1 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=miaA1 PE=3 SV=1 51 382 5.0E-30
sp|B0RGZ2|MIAA_CLAMS tRNA dimethylallyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=miaA PE=3 SV=1 50 368 5.0E-30
sp|A1VLE3|MIAA_POLNA tRNA dimethylallyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=miaA PE=3 SV=1 45 368 5.0E-30
sp|Q03KD9|MIAA_STRTD tRNA dimethylallyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=miaA PE=3 SV=1 50 361 5.0E-30
sp|B2RLA0|MIAA2_PORG3 tRNA dimethylallyltransferase 2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=miaA2 PE=3 SV=1 51 382 6.0E-30
sp|B2HGM7|MIAA1_MYCMM tRNA dimethylallyltransferase 1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=miaA1 PE=3 SV=1 52 361 6.0E-30
sp|Q4ULK8|MIAA_RICFE tRNA dimethylallyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=miaA PE=3 SV=1 49 366 7.0E-30
sp|Q0AJ07|MIAA_NITEC tRNA dimethylallyltransferase OS=Nitrosomonas eutropha (strain C91) GN=miaA PE=3 SV=1 52 361 8.0E-30
sp|Q1IHU1|MIAA_KORVE tRNA dimethylallyltransferase OS=Koribacter versatilis (strain Ellin345) GN=miaA PE=3 SV=1 51 375 9.0E-30
sp|A9G9R0|MIAA_SORC5 tRNA dimethylallyltransferase OS=Sorangium cellulosum (strain So ce56) GN=miaA PE=3 SV=1 20 361 9.0E-30
sp|A3PYF8|MIAA_MYCSJ tRNA dimethylallyltransferase OS=Mycobacterium sp. (strain JLS) GN=miaA PE=3 SV=1 52 361 1.0E-29
sp|B3WF00|MIAA_LACCB tRNA dimethylallyltransferase OS=Lactobacillus casei (strain BL23) GN=miaA PE=3 SV=1 47 320 1.0E-29
sp|Q038E3|MIAA_LACC3 tRNA dimethylallyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=miaA PE=3 SV=1 47 320 1.0E-29
sp|B4U3M4|MIAA_STREM tRNA dimethylallyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=miaA PE=3 SV=1 49 394 1.0E-29
sp|Q5LZH6|MIAA_STRT1 tRNA dimethylallyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=miaA PE=3 SV=2 51 361 1.0E-29
sp|Q9WYZ5|MIAA_THEMA tRNA dimethylallyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=miaA PE=3 SV=1 53 364 1.0E-29
sp|A4FAJ5|MIAA_SACEN tRNA dimethylallyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=miaA PE=3 SV=1 39 361 1.0E-29
sp|Q820J6|MIAA_NITEU tRNA dimethylallyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=miaA PE=3 SV=1 50 361 1.0E-29
sp|C0MAN2|MIAA_STRE4 tRNA dimethylallyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=miaA PE=3 SV=1 49 394 1.0E-29
sp|Q9X5G1|MIAA_ZYMMO tRNA dimethylallyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=miaA PE=3 SV=2 41 361 2.0E-29
sp|C0MDJ6|MIAA_STRS7 tRNA dimethylallyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=miaA PE=3 SV=1 49 394 2.0E-29
sp|Q9Z6Z6|MIAA_CHLPN tRNA dimethylallyltransferase OS=Chlamydia pneumoniae GN=miaA PE=3 SV=1 51 321 2.0E-29
sp|B5YK93|MIAA_THEYD tRNA dimethylallyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=miaA PE=3 SV=1 51 361 2.0E-29
sp|Q310R5|MIAA_DESAG tRNA dimethylallyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=miaA PE=3 SV=2 50 361 2.0E-29
sp|Q5XCI0|MIAA_STRP6 tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=miaA PE=3 SV=1 50 361 2.0E-29
sp|B2G870|MIAA_LACRJ tRNA dimethylallyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=miaA PE=3 SV=1 51 379 2.0E-29
sp|A5VKT6|MIAA_LACRD tRNA dimethylallyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=miaA PE=3 SV=1 51 379 2.0E-29
sp|Q2KX23|MIAA_BORA1 tRNA dimethylallyltransferase OS=Bordetella avium (strain 197N) GN=miaA PE=3 SV=1 48 361 3.0E-29
sp|B5XL33|MIAA_STRPZ tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=miaA PE=3 SV=1 50 396 3.0E-29
sp|Q1BA14|MIAA_MYCSS tRNA dimethylallyltransferase OS=Mycobacterium sp. (strain MCS) GN=miaA PE=3 SV=1 52 361 3.0E-29
sp|A1UEZ8|MIAA_MYCSK tRNA dimethylallyltransferase OS=Mycobacterium sp. (strain KMS) GN=miaA PE=3 SV=1 52 361 3.0E-29
sp|Q65ZV3|MIAA_BORBP tRNA dimethylallyltransferase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=miaA PE=3 SV=1 51 316 4.0E-29
sp|A8AWX1|MIAA_STRGC tRNA dimethylallyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=miaA PE=3 SV=1 51 361 4.0E-29
sp|Q0AN24|MIAA_MARMM tRNA dimethylallyltransferase OS=Maricaulis maris (strain MCS10) GN=miaA PE=3 SV=1 50 379 5.0E-29
sp|B6EMQ8|MIAA_ALISL tRNA dimethylallyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=miaA PE=3 SV=1 52 375 5.0E-29
sp|A8M7W9|MIAA_SALAI tRNA dimethylallyltransferase OS=Salinispora arenicola (strain CNS-205) GN=miaA PE=3 SV=1 23 361 6.0E-29
sp|Q88WP5|MIAA_LACPL tRNA dimethylallyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=miaA PE=3 SV=1 51 363 6.0E-29
sp|Q8P9X8|MIAA_XANCP tRNA dimethylallyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=miaA PE=3 SV=1 52 379 6.0E-29
sp|Q4UTQ7|MIAA_XANC8 tRNA dimethylallyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=miaA PE=3 SV=1 52 379 6.0E-29
sp|Q0SM30|MIAA_BORAP tRNA dimethylallyltransferase OS=Borrelia afzelii (strain PKo) GN=miaA PE=3 SV=1 51 316 7.0E-29
sp|B2FL25|MIAA_STRMK tRNA dimethylallyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=miaA PE=3 SV=1 52 361 7.0E-29
sp|C1CQE9|MIAA_STRZT tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=miaA PE=3 SV=1 51 376 7.0E-29
sp|P0DC33|MIAA_STRPQ tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=miaA PE=3 SV=1 50 396 8.0E-29
sp|P65358|MIAA_STRP8 tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=miaA PE=3 SV=1 50 396 8.0E-29
sp|P0DC32|MIAA_STRP3 tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=miaA PE=3 SV=1 50 396 8.0E-29
sp|Q11RE0|MIAA_CYTH3 tRNA dimethylallyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=miaA PE=3 SV=1 51 360 8.0E-29
sp|B0TU65|MIAA_SHEHH tRNA dimethylallyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=miaA PE=3 SV=1 48 379 9.0E-29
sp|Q73RN1|MIAA1_TREDE tRNA dimethylallyltransferase 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=miaA1 PE=3 SV=1 50 361 1.0E-28
sp|Q128B6|MIAA_POLSJ tRNA dimethylallyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=miaA PE=3 SV=1 52 368 1.0E-28
sp|A9NCK4|MIAA_COXBR tRNA dimethylallyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=miaA PE=3 SV=1 50 379 1.0E-28
sp|B2GD80|MIAA_LACF3 tRNA dimethylallyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=miaA PE=3 SV=1 51 361 1.0E-28
sp|Q7MBE2|MIAA_CHRVO tRNA dimethylallyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=miaA PE=3 SV=1 52 361 1.0E-28
sp|Q820W3|MIAA_COXBU tRNA dimethylallyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=miaA PE=3 SV=1 50 379 1.0E-28
sp|A9KE31|MIAA_COXBN tRNA dimethylallyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=miaA PE=3 SV=1 50 379 1.0E-28
sp|Q73W20|MIAA_MYCPA tRNA dimethylallyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=miaA PE=3 SV=1 54 361 2.0E-28
sp|Q1LJ94|MIAA_CUPMC tRNA dimethylallyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=miaA PE=3 SV=1 50 361 2.0E-28
sp|B0RTZ0|MIAA_XANCB tRNA dimethylallyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=miaA PE=3 SV=1 52 379 2.0E-28
sp|Q47B80|MIAA_DECAR tRNA dimethylallyltransferase OS=Dechloromonas aromatica (strain RCB) GN=miaA PE=3 SV=1 46 315 2.0E-28
sp|B8ZMQ3|MIAA_STRPJ tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=miaA PE=3 SV=1 51 376 2.0E-28
sp|A5CW57|MIAA_VESOH tRNA dimethylallyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=miaA PE=3 SV=1 48 361 2.0E-28
sp|A0QIQ9|MIAA_MYCA1 tRNA dimethylallyltransferase OS=Mycobacterium avium (strain 104) GN=miaA PE=3 SV=1 52 384 2.0E-28
sp|A1AX35|MIAA_RUTMC tRNA dimethylallyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=miaA PE=3 SV=1 48 384 2.0E-28
sp|Q48TZ1|MIAA_STRPM tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=miaA PE=3 SV=1 50 396 2.0E-28
sp|B3R0E8|MIAA_PHYMT tRNA dimethylallyltransferase OS=Phytoplasma mali (strain AT) GN=miaA PE=3 SV=1 49 366 2.0E-28
sp|A2REY5|MIAA_STRPG tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=miaA PE=3 SV=1 50 396 2.0E-28
sp|Q1JM45|MIAA_STRPC tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=miaA PE=3 SV=1 50 396 2.0E-28
sp|Q1JC62|MIAA_STRPB tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=miaA PE=3 SV=1 50 396 2.0E-28
sp|B1L8X0|MIAA_THESQ tRNA dimethylallyltransferase OS=Thermotoga sp. (strain RQ2) GN=miaA PE=3 SV=1 53 361 3.0E-28
sp|B5E2R3|MIAA_STRP4 tRNA dimethylallyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=miaA PE=3 SV=1 51 376 3.0E-28
sp|A1WUT7|MIAA_HALHL tRNA dimethylallyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=miaA PE=3 SV=1 48 363 3.0E-28
sp|A2RIU4|MIAA_LACLM tRNA dimethylallyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=miaA PE=3 SV=1 50 380 3.0E-28
sp|Q031A8|MIAA_LACLS tRNA dimethylallyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=miaA PE=3 SV=1 47 380 3.0E-28
sp|Q9LJL4|IPT8_ARATH Adenylate isopentenyltransferase 8, chloroplastic OS=Arabidopsis thaliana GN=IPT8 PE=2 SV=1 1 156 3.0E-28
sp|O84771|MIAA_CHLTR tRNA dimethylallyltransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=miaA PE=3 SV=2 51 372 3.0E-28
sp|B0BAM1|MIAA_CHLTB tRNA dimethylallyltransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=miaA PE=3 SV=1 51 372 4.0E-28
sp|B0B8Z2|MIAA_CHLT2 tRNA dimethylallyltransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=miaA PE=3 SV=1 51 372 4.0E-28
sp|A8EYU8|MIAA_RICCK tRNA dimethylallyltransferase OS=Rickettsia canadensis (strain McKiel) GN=miaA PE=3 SV=1 51 361 4.0E-28
sp|Q8CWS7|MIAA_STRR6 tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=miaA PE=3 SV=2 51 376 4.0E-28
sp|Q04LL6|MIAA_STRP2 tRNA dimethylallyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=miaA PE=3 SV=1 51 376 4.0E-28
sp|O51761|MIAA_BORBU tRNA dimethylallyltransferase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=miaA PE=3 SV=1 51 316 4.0E-28
sp|B7J0R6|MIAA_BORBZ tRNA dimethylallyltransferase OS=Borrelia burgdorferi (strain ZS7) GN=miaA PE=3 SV=1 51 316 5.0E-28
sp|Q68WM5|MIAA_RICTY tRNA dimethylallyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=miaA PE=3 SV=1 49 360 5.0E-28
sp|Q9C5J6|IPT9_ARATH tRNA dimethylallyltransferase 9 OS=Arabidopsis thaliana GN=IPT9 PE=2 SV=1 23 365 6.0E-28
sp|A9W640|MIAA_METEP tRNA dimethylallyltransferase OS=Methylobacterium extorquens (strain PA1) GN=miaA PE=3 SV=1 52 379 6.0E-28
sp|A7IFW1|MIAA_XANP2 tRNA dimethylallyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=miaA PE=3 SV=1 52 361 7.0E-28
sp|B8F662|MIAA_HAEPS tRNA dimethylallyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=miaA PE=3 SV=1 52 361 8.0E-28
sp|A9M4D3|MIAA_NEIM0 tRNA dimethylallyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=miaA PE=3 SV=2 47 386 8.0E-28
sp|A8H8G7|MIAA_SHEPA tRNA dimethylallyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=miaA PE=3 SV=1 55 361 9.0E-28
sp|B1IAK9|MIAA_STRPI tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=miaA PE=3 SV=1 51 376 1.0E-27
sp|Q1JH90|MIAA_STRPD tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=miaA PE=3 SV=1 50 396 1.0E-27
sp|Q9A059|MIAA_STRP1 tRNA dimethylallyltransferase OS=Streptococcus pyogenes serotype M1 GN=miaA PE=3 SV=1 50 396 1.0E-27
sp|B6J017|MIAA_COXB2 tRNA dimethylallyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=miaA PE=3 SV=1 55 379 1.0E-27
sp|B6J7C0|MIAA_COXB1 tRNA dimethylallyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=miaA PE=3 SV=1 55 379 1.0E-27
sp|Q3KKS6|MIAA_CHLTA tRNA dimethylallyltransferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=miaA PE=3 SV=1 51 372 1.0E-27
sp|B1VXU2|MIAA_STRGG tRNA dimethylallyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=miaA PE=3 SV=1 46 361 1.0E-27
sp|Q2SBC1|MIAA2_HAHCH tRNA dimethylallyltransferase 2 OS=Hahella chejuensis (strain KCTC 2396) GN=miaA2 PE=3 SV=1 50 368 1.0E-27
sp|B9DUP8|MIAA_STRU0 tRNA dimethylallyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=miaA PE=3 SV=1 49 361 2.0E-27
sp|A0L4B0|MIAA_MAGMM tRNA dimethylallyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=miaA PE=3 SV=1 55 361 2.0E-27
sp|Q0AB61|MIAA_ALKEH tRNA dimethylallyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=miaA PE=3 SV=1 42 361 2.0E-27
sp|Q03VI2|MIAA_LEUMM tRNA dimethylallyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=miaA PE=3 SV=1 50 376 2.0E-27
sp|O69967|MIAA_STRCO tRNA dimethylallyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=miaA PE=3 SV=1 45 361 2.0E-27
sp|A8L6K0|MIAA_FRASN tRNA dimethylallyltransferase OS=Frankia sp. (strain EAN1pec) GN=miaA PE=3 SV=1 39 361 2.0E-27
sp|Q9ZD37|MIAA_RICPR tRNA dimethylallyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=miaA PE=3 SV=1 49 360 3.0E-27
sp|Q5NXR4|MIAA_AROAE tRNA dimethylallyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=miaA PE=3 SV=2 52 389 3.0E-27
sp|Q8R5Z6|MIAA_FUSNN tRNA dimethylallyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=miaA PE=3 SV=1 52 361 3.0E-27
sp|A6W849|MIAA_KINRD tRNA dimethylallyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=miaA PE=3 SV=1 47 361 3.0E-27
sp|A0PTG1|MIAA2_MYCUA tRNA dimethylallyltransferase 2 OS=Mycobacterium ulcerans (strain Agy99) GN=miaA2 PE=3 SV=1 52 361 3.0E-27
sp|B2IMY5|MIAA_STRPS tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=miaA PE=3 SV=2 51 376 3.0E-27
sp|Q97RW5|MIAA_STRPN tRNA dimethylallyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=miaA PE=1 SV=1 51 376 3.0E-27
sp|B7KQF6|MIAA_METC4 tRNA dimethylallyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=miaA PE=3 SV=1 52 378 3.0E-27
sp|Q0VME6|MIAA_ALCBS tRNA dimethylallyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=miaA PE=3 SV=1 50 366 4.0E-27
sp|B1M537|MIAA_METRJ tRNA dimethylallyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=miaA PE=3 SV=1 52 361 4.0E-27
sp|B4SRA4|MIAA_STRM5 tRNA dimethylallyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=miaA PE=3 SV=1 52 361 5.0E-27
sp|Q5F852|MIAA_NEIG1 tRNA dimethylallyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=miaA PE=3 SV=1 47 386 5.0E-27
sp|A8AMN0|MIAA_CITK8 tRNA dimethylallyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=miaA PE=3 SV=1 52 374 6.0E-27
sp|C1CJD7|MIAA_STRZP tRNA dimethylallyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=miaA PE=3 SV=1 51 376 7.0E-27
sp|A4X4W1|MIAA_SALTO tRNA dimethylallyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=miaA PE=3 SV=1 51 361 8.0E-27
sp|A0QVX9|MIAA_MYCS2 tRNA dimethylallyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=miaA PE=3 SV=1 52 361 1.0E-26
sp|Q1J022|MIAA_DEIGD tRNA dimethylallyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=miaA PE=3 SV=1 50 361 1.0E-26
sp|A1R0P6|MIAA_BORT9 tRNA dimethylallyltransferase OS=Borrelia turicatae (strain 91E135) GN=miaA PE=3 SV=1 51 316 1.0E-26
sp|Q6NGR5|MIAA_CORDI tRNA dimethylallyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=miaA PE=3 SV=1 47 361 2.0E-26
sp|B4RL47|MIAA_NEIG2 tRNA dimethylallyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=miaA PE=3 SV=1 47 386 2.0E-26
sp|Q318A6|MIAA_PROM9 tRNA dimethylallyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=miaA PE=3 SV=1 51 364 2.0E-26
sp|Q9PLF7|MIAA_CHLMU tRNA dimethylallyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=miaA PE=3 SV=1 51 361 2.0E-26
sp|Q8NP72|MIAA_CORGL tRNA dimethylallyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=miaA PE=3 SV=1 52 360 2.0E-26
sp|A8IAX3|MIAA_AZOC5 tRNA dimethylallyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=miaA PE=3 SV=1 45 374 2.0E-26
sp|P44495|MIAA_HAEIN tRNA dimethylallyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=miaA PE=3 SV=1 52 363 2.0E-26
sp|A4QEV2|MIAA_CORGB tRNA dimethylallyltransferase OS=Corynebacterium glutamicum (strain R) GN=miaA PE=3 SV=1 52 360 2.0E-26
sp|C6BXG0|MIAA_DESAD tRNA dimethylallyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=miaA PE=3 SV=1 50 325 2.0E-26
sp|Q2J773|MIAA_FRASC tRNA dimethylallyltransferase OS=Frankia sp. (strain CcI3) GN=miaA PE=3 SV=1 52 361 3.0E-26
sp|B0TZB0|MIAA_FRAP2 tRNA dimethylallyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=miaA PE=3 SV=1 56 363 3.0E-26
sp|Q3A503|MIAA1_PELCD tRNA dimethylallyltransferase 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=miaA1 PE=3 SV=1 50 360 3.0E-26
sp|B2HL15|MIAA2_MYCMM tRNA dimethylallyltransferase 2 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=miaA2 PE=3 SV=1 52 361 3.0E-26
sp|A9NGL4|MIAA_ACHLI tRNA dimethylallyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=miaA PE=3 SV=1 49 366 3.0E-26
sp|Q145C5|MIAA_BURXL tRNA dimethylallyltransferase OS=Burkholderia xenovorans (strain LB400) GN=miaA PE=3 SV=1 43 361 4.0E-26
sp|A5UB70|MIAA_HAEIE tRNA dimethylallyltransferase OS=Haemophilus influenzae (strain PittEE) GN=miaA PE=3 SV=1 52 363 4.0E-26
sp|B1Y5G6|MIAA_LEPCP tRNA dimethylallyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=miaA PE=3 SV=1 45 361 4.0E-26
sp|Q4QPH6|MIAA_HAEI8 tRNA dimethylallyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=miaA PE=3 SV=1 52 363 4.0E-26
sp|Q7TV89|MIAA_PROMA tRNA dimethylallyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=miaA PE=3 SV=1 47 361 5.0E-26
sp|B1MD01|MIAA_MYCA9 tRNA dimethylallyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=miaA PE=3 SV=1 52 290 5.0E-26
sp|P9WJW1|MIAA_MYCTU tRNA dimethylallyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=miaA PE=1 SV=1 52 361 5.0E-26
sp|P9WJW0|MIAA_MYCTO tRNA dimethylallyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=miaA PE=3 SV=1 52 361 5.0E-26
sp|A5U679|MIAA_MYCTA tRNA dimethylallyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=miaA PE=3 SV=1 52 361 5.0E-26
sp|C1AFI6|MIAA_MYCBT tRNA dimethylallyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=miaA PE=3 SV=1 52 361 5.0E-26
sp|A1KM65|MIAA_MYCBP tRNA dimethylallyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=miaA PE=3 SV=1 52 361 5.0E-26
sp|P65353|MIAA_MYCBO tRNA dimethylallyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=miaA PE=3 SV=1 52 361 5.0E-26
sp|Q82KC8|MIAA_STRAW tRNA dimethylallyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=miaA PE=3 SV=1 45 361 5.0E-26
sp|A6LDS8|MIAA2_PARD8 tRNA dimethylallyltransferase 2 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=miaA2 PE=3 SV=1 51 361 5.0E-26
sp|Q3IDT9|MIAA_PSEHT tRNA dimethylallyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=miaA PE=3 SV=1 50 361 6.0E-26
sp|B1ZDL3|MIAA_METPB tRNA dimethylallyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=miaA PE=3 SV=1 52 379 6.0E-26
sp|A4J5Q1|MIAA_DESRM tRNA dimethylallyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=miaA PE=3 SV=1 77 371 6.0E-26
sp|B8IEX6|MIAA_METNO tRNA dimethylallyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=miaA PE=3 SV=1 52 361 6.0E-26
sp|B8GNC6|MIAA_THISH tRNA dimethylallyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=miaA PE=3 SV=1 46 361 7.0E-26
sp|B2IKE2|MIAA_BEII9 tRNA dimethylallyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=miaA PE=3 SV=1 52 290 7.0E-26
sp|Q07XW6|MIAA_SHEFN tRNA dimethylallyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=miaA PE=3 SV=1 55 361 7.0E-26
sp|Q9JUU5|MIAA_NEIMA tRNA dimethylallyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=miaA PE=3 SV=1 47 386 8.0E-26
sp|A9IW77|MIAA_BART1 tRNA dimethylallyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=miaA PE=3 SV=1 51 361 9.0E-26
sp|P46811|MIAA_MYCLE tRNA dimethylallyltransferase OS=Mycobacterium leprae (strain TN) GN=miaA PE=3 SV=1 52 322 9.0E-26
sp|B8ZQU0|MIAA_MYCLB tRNA dimethylallyltransferase OS=Mycobacterium leprae (strain Br4923) GN=miaA PE=3 SV=1 52 322 9.0E-26
sp|Q87L06|MIAA_VIBPA tRNA dimethylallyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=miaA PE=3 SV=1 52 361 1.0E-25
sp|B7VI54|MIAA_VIBTL tRNA dimethylallyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=miaA PE=3 SV=1 52 361 1.0E-25
sp|B0U1E8|MIAA_XYLFM tRNA dimethylallyltransferase OS=Xylella fastidiosa (strain M12) GN=miaA PE=3 SV=1 52 361 1.0E-25
sp|Q5YT12|MIAA_NOCFA tRNA dimethylallyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=miaA PE=3 SV=1 52 361 1.0E-25
sp|B3R6B8|MIAA_CUPTR tRNA dimethylallyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=miaA PE=3 SV=1 45 368 1.0E-25
sp|Q5E2C7|MIAA_VIBF1 tRNA dimethylallyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=miaA PE=3 SV=1 45 379 1.0E-25
sp|B6YRM5|MIAA2_AZOPC tRNA dimethylallyltransferase 2 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=miaA2 PE=3 SV=1 51 361 1.0E-25
sp|B5FBR5|MIAA_VIBFM tRNA dimethylallyltransferase OS=Vibrio fischeri (strain MJ11) GN=miaA PE=3 SV=1 52 379 2.0E-25
sp|A0PT81|MIAA1_MYCUA tRNA dimethylallyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=miaA1 PE=3 SV=1 52 361 2.0E-25
sp|Q0I462|MIAA_HAES1 tRNA dimethylallyltransferase OS=Haemophilus somnus (strain 129Pt) GN=miaA PE=3 SV=1 52 363 2.0E-25
sp|Q9CMC7|MIAA_PASMU tRNA dimethylallyltransferase OS=Pasteurella multocida (strain Pm70) GN=miaA PE=3 SV=2 46 363 2.0E-25
sp|Q21HA1|MIAA_SACD2 tRNA dimethylallyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=miaA PE=3 SV=1 52 375 2.0E-25
sp|B0UUU6|MIAA_HISS2 tRNA dimethylallyltransferase OS=Histophilus somni (strain 2336) GN=miaA PE=3 SV=1 52 363 2.0E-25
sp|Q21Y86|MIAA_RHOFT tRNA dimethylallyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=miaA PE=3 SV=1 52 379 2.0E-25
sp|A1U4C6|MIAA_MARHV tRNA dimethylallyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=miaA PE=3 SV=1 50 376 2.0E-25
sp|C3LR78|MIAA_VIBCM tRNA dimethylallyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=miaA PE=3 SV=1 52 379 2.0E-25
sp|Q9KV12|MIAA_VIBCH tRNA dimethylallyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=miaA PE=3 SV=1 52 379 2.0E-25
sp|A5F3L6|MIAA_VIBC3 tRNA dimethylallyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=miaA PE=3 SV=1 52 379 2.0E-25
sp|A6VYL7|MIAA_MARMS tRNA dimethylallyltransferase OS=Marinomonas sp. (strain MWYL1) GN=miaA PE=3 SV=1 48 376 2.0E-25
sp|A1KTK4|MIAA_NEIMF tRNA dimethylallyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=miaA PE=3 SV=1 47 361 2.0E-25
sp|Q1RIF4|MIAA_RICBR tRNA dimethylallyltransferase OS=Rickettsia bellii (strain RML369-C) GN=miaA PE=3 SV=1 47 391 2.0E-25
sp|B8CIX4|MIAA_SHEPW tRNA dimethylallyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=miaA PE=3 SV=1 51 361 3.0E-25
sp|Q0RDX5|MIAA_FRAAA tRNA dimethylallyltransferase OS=Frankia alni (strain ACN14a) GN=miaA PE=3 SV=1 55 384 3.0E-25
sp|A1BFE5|MIAA_CHLPD tRNA dimethylallyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=miaA PE=3 SV=1 49 361 3.0E-25
sp|B3EIU4|MIAA_CHLL2 tRNA dimethylallyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=miaA PE=3 SV=1 49 361 3.0E-25
sp|C5CD61|MIAA_KOSOT tRNA dimethylallyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=miaA PE=3 SV=1 53 368 3.0E-25
sp|Q9PH56|MIAA_XYLFA tRNA dimethylallyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=miaA PE=3 SV=1 52 361 3.0E-25
sp|Q46XK2|MIAA_CUPPJ tRNA dimethylallyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=miaA PE=3 SV=1 50 361 3.0E-25
sp|B9MCW1|MIAA_ACIET tRNA dimethylallyltransferase OS=Acidovorax ebreus (strain TPSY) GN=miaA PE=3 SV=1 50 379 4.0E-25
sp|Q8CWK9|MIAA_VIBVU tRNA dimethylallyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=miaA PE=3 SV=2 52 365 4.0E-25
sp|A7MX77|MIAA_VIBCB tRNA dimethylallyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=miaA PE=3 SV=1 52 365 4.0E-25
sp|Q87F70|MIAA_XYLFT tRNA dimethylallyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=miaA PE=3 SV=1 52 361 5.0E-25
sp|B2I692|MIAA_XYLF2 tRNA dimethylallyltransferase OS=Xylella fastidiosa (strain M23) GN=miaA PE=3 SV=1 52 361 5.0E-25
sp|Q2NJ30|MIAA_AYWBP tRNA dimethylallyltransferase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=miaA PE=3 SV=1 49 361 5.0E-25
sp|B0BTY5|MIAA_ACTPJ tRNA dimethylallyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=miaA PE=3 SV=1 52 361 5.0E-25
sp|A0Q6S4|MIAA_FRATN tRNA dimethylallyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=miaA PE=3 SV=1 56 361 5.0E-25
sp|B4SGR0|MIAA_PELPB tRNA dimethylallyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=miaA PE=3 SV=1 41 360 5.0E-25
sp|Q9JZR0|MIAA_NEIMB tRNA dimethylallyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=miaA PE=3 SV=1 47 386 5.0E-25
sp|B2T068|MIAA_BURPP tRNA dimethylallyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=miaA PE=3 SV=2 43 361 6.0E-25
sp|Q8A018|MIAA1_BACTN tRNA dimethylallyltransferase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=miaA1 PE=3 SV=1 51 362 7.0E-25
sp|Q94ID1|IPT7_ARATH Adenylate isopentenyltransferase 7, mitochondrial OS=Arabidopsis thaliana GN=IPT7 PE=2 SV=2 47 156 7.0E-25
sp|Q0K776|MIAA_CUPNH tRNA dimethylallyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=miaA PE=3 SV=1 50 361 8.0E-25
sp|Q7M7I8|MIAA_VIBVY tRNA dimethylallyltransferase OS=Vibrio vulnificus (strain YJ016) GN=miaA PE=3 SV=1 52 365 8.0E-25
sp|B8J3C2|MIAA_DESDA tRNA dimethylallyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=miaA PE=3 SV=1 33 287 8.0E-25
sp|Q7MAX8|MIAA_PHOLL tRNA dimethylallyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=miaA PE=3 SV=1 52 384 9.0E-25
sp|A6TH86|MIAA_KLEP7 tRNA dimethylallyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=miaA PE=3 SV=1 52 374 1.0E-24
sp|B5Y333|MIAA_KLEP3 tRNA dimethylallyltransferase OS=Klebsiella pneumoniae (strain 342) GN=miaA PE=3 SV=1 52 374 1.0E-24
sp|Q0HR41|MIAA_SHESR tRNA dimethylallyltransferase OS=Shewanella sp. (strain MR-7) GN=miaA PE=3 SV=1 55 368 1.0E-24
sp|A0LZ43|MIAA_GRAFK tRNA dimethylallyltransferase OS=Gramella forsetii (strain KT0803) GN=miaA PE=3 SV=1 51 361 1.0E-24
sp|Q3KIZ0|MIAA_PSEPF tRNA dimethylallyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=miaA PE=3 SV=1 50 365 1.0E-24
sp|Q9SB60|IPT4_ARATH Adenylate isopentenyltransferase 4 OS=Arabidopsis thaliana GN=IPT4 PE=1 SV=1 48 156 1.0E-24
sp|B1VDE1|MIAA_CORU7 tRNA dimethylallyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=miaA PE=3 SV=1 39 361 1.0E-24
sp|Q1H1I4|MIAA_METFK tRNA dimethylallyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=miaA PE=3 SV=1 50 361 1.0E-24
sp|A7MM88|MIAA_CROS8 tRNA dimethylallyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=miaA PE=3 SV=1 52 378 1.0E-24
sp|Q6LM29|MIAA_PHOPR tRNA dimethylallyltransferase OS=Photobacterium profundum GN=miaA PE=3 SV=1 45 375 1.0E-24
sp|A5IAM8|MIAA_LEGPC tRNA dimethylallyltransferase OS=Legionella pneumophila (strain Corby) GN=miaA PE=3 SV=1 51 361 1.0E-24
sp|B4F265|MIAA_PROMH tRNA dimethylallyltransferase OS=Proteus mirabilis (strain HI4320) GN=miaA PE=3 SV=1 52 361 1.0E-24
sp|A8GWV8|MIAA_RICB8 tRNA dimethylallyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=miaA PE=3 SV=1 51 391 1.0E-24
sp|B7UQI0|MIAA_ECO27 tRNA dimethylallyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=miaA PE=3 SV=1 52 395 1.0E-24
sp|B2TY46|MIAA_SHIB3 tRNA dimethylallyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=miaA PE=3 SV=1 52 395 2.0E-24
sp|Q15NR1|MIAA_PSEA6 tRNA dimethylallyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=miaA PE=3 SV=1 50 379 2.0E-24
sp|Q5WTA1|MIAA_LEGPL tRNA dimethylallyltransferase OS=Legionella pneumophila (strain Lens) GN=miaA PE=3 SV=1 51 361 2.0E-24
sp|Q8FPE0|MIAA_COREF tRNA dimethylallyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=miaA PE=3 SV=1 52 362 2.0E-24
sp|A1WAG1|MIAA_ACISJ tRNA dimethylallyltransferase OS=Acidovorax sp. (strain JS42) GN=miaA PE=3 SV=1 50 379 2.0E-24
sp|A1VDU9|MIAA_DESVV tRNA dimethylallyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=miaA PE=3 SV=1 51 381 2.0E-24
sp|Q72BV1|MIAA_DESVH tRNA dimethylallyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=miaA PE=3 SV=1 51 381 2.0E-24
sp|B8JBF4|MIAA_ANAD2 tRNA dimethylallyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=miaA PE=3 SV=1 51 364 2.0E-24
sp|Q65SD6|MIAA_MANSM tRNA dimethylallyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=miaA PE=3 SV=1 52 363 2.0E-24
sp|Q2W1G5|MIAA_MAGSA tRNA dimethylallyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=miaA PE=3 SV=1 48 368 2.0E-24
sp|B3H330|MIAA_ACTP7 tRNA dimethylallyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=miaA PE=3 SV=2 55 361 2.0E-24
sp|Q98KJ4|MIAA_RHILO tRNA dimethylallyltransferase OS=Rhizobium loti (strain MAFF303099) GN=miaA PE=3 SV=1 52 366 2.0E-24
sp|Q2IUR8|MIAA_RHOP2 tRNA dimethylallyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=miaA PE=3 SV=1 52 361 2.0E-24
sp|B8DNS7|MIAA_DESVM tRNA dimethylallyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=miaA PE=3 SV=1 45 409 2.0E-24
sp|Q2YCX0|MIAA_NITMU tRNA dimethylallyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=miaA PE=3 SV=1 47 384 3.0E-24
sp|C1DLQ1|MIAA_AZOVD tRNA dimethylallyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=miaA PE=3 SV=1 50 374 3.0E-24
sp|A4IYB1|MIAA_FRATW tRNA dimethylallyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|Q5NH42|MIAA_FRATT tRNA dimethylallyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|Q0BM87|MIAA_FRATO tRNA dimethylallyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|B2SG23|MIAA_FRATM tRNA dimethylallyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|Q2A3T6|MIAA_FRATH tRNA dimethylallyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|A7NBS1|MIAA_FRATF tRNA dimethylallyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|Q14IJ4|MIAA_FRAT1 tRNA dimethylallyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=miaA PE=3 SV=1 56 361 3.0E-24
sp|Q8D318|MIAA_WIGBR tRNA dimethylallyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=miaA PE=3 SV=1 52 392 3.0E-24
sp|Q47RR4|MIAA_THEFY tRNA dimethylallyltransferase OS=Thermobifida fusca (strain YX) GN=miaA PE=3 SV=1 51 396 3.0E-24
sp|P59197|MIAA_SHIFL tRNA dimethylallyltransferase OS=Shigella flexneri GN=miaA PE=3 SV=1 52 395 3.0E-24
sp|B0V7B1|MIAA_ACIBY tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain AYE) GN=miaA PE=3 SV=1 50 361 3.0E-24
sp|A3M6J6|MIAA_ACIBT tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=miaA PE=3 SV=2 50 361 3.0E-24
sp|B2HTT5|MIAA_ACIBC tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=miaA PE=3 SV=1 50 361 3.0E-24
sp|B7IAP6|MIAA_ACIB5 tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=miaA PE=3 SV=1 50 361 3.0E-24
sp|B7H141|MIAA_ACIB3 tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=miaA PE=3 SV=1 50 361 3.0E-24
sp|Q2SYY3|MIAA_BURTA tRNA dimethylallyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=miaA PE=3 SV=1 54 325 3.0E-24
sp|Q8CWM5|MIAA_THEEB tRNA dimethylallyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=miaA PE=3 SV=1 51 320 4.0E-24
sp|B1XRT3|MIAA_POLNS tRNA dimethylallyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=miaA PE=3 SV=1 50 367 4.0E-24
sp|Q1R389|MIAA_ECOUT tRNA dimethylallyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=miaA PE=3 SV=1 52 395 4.0E-24
sp|A1AJ77|MIAA_ECOK1 tRNA dimethylallyltransferase OS=Escherichia coli O1:K1 / APEC GN=miaA PE=3 SV=1 52 395 4.0E-24
sp|B7MKX5|MIAA_ECO45 tRNA dimethylallyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=miaA PE=3 SV=1 52 395 4.0E-24
sp|B5RQF8|MIAA_BORRA tRNA dimethylallyltransferase OS=Borrelia recurrentis (strain A1) GN=miaA PE=3 SV=1 48 316 4.0E-24
sp|A5EXM7|MIAA_DICNV tRNA dimethylallyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=miaA PE=3 SV=1 51 360 4.0E-24
sp|Q8CXV3|MIAA_ECOL6 tRNA dimethylallyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=miaA PE=3 SV=1 52 395 4.0E-24
sp|B7MSY4|MIAA_ECO81 tRNA dimethylallyltransferase OS=Escherichia coli O81 (strain ED1a) GN=miaA PE=3 SV=1 52 395 4.0E-24
sp|A1A279|MIAA_BIFAA tRNA dimethylallyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=miaA PE=3 SV=1 46 325 4.0E-24
sp|B0VM64|MIAA_ACIBS tRNA dimethylallyltransferase OS=Acinetobacter baumannii (strain SDF) GN=miaA PE=3 SV=1 50 361 4.0E-24
sp|B5RN19|MIAA_BORDL tRNA dimethylallyltransferase OS=Borrelia duttonii (strain Ly) GN=miaA PE=3 SV=1 48 316 4.0E-24
sp|B9JXP7|MIAA_AGRVS tRNA dimethylallyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=miaA PE=3 SV=1 52 361 5.0E-24
sp|Q4FPN1|MIAA_PELUB tRNA dimethylallyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=miaA PE=3 SV=1 51 361 5.0E-24
sp|A0KSR6|MIAA_SHESA tRNA dimethylallyltransferase OS=Shewanella sp. (strain ANA-3) GN=miaA PE=3 SV=1 55 368 5.0E-24
sp|A9MFP1|MIAA_SALAR tRNA dimethylallyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=miaA PE=3 SV=1 52 374 5.0E-24
sp|Q5X1J2|MIAA_LEGPA tRNA dimethylallyltransferase OS=Legionella pneumophila (strain Paris) GN=miaA PE=3 SV=1 51 361 5.0E-24
sp|Q3YUH2|MIAA_SHISS tRNA dimethylallyltransferase OS=Shigella sonnei (strain Ss046) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|Q0SXB1|MIAA_SHIF8 tRNA dimethylallyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=miaA PE=3 SV=2 52 395 6.0E-24
sp|Q31TA1|MIAA_SHIBS tRNA dimethylallyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|B6I275|MIAA_ECOSE tRNA dimethylallyltransferase OS=Escherichia coli (strain SE11) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|P16384|MIAA_ECOLI tRNA dimethylallyltransferase OS=Escherichia coli (strain K12) GN=miaA PE=1 SV=2 52 395 6.0E-24
sp|B1IT35|MIAA_ECOLC tRNA dimethylallyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|A8A7R5|MIAA_ECOHS tRNA dimethylallyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|B1XDS2|MIAA_ECODH tRNA dimethylallyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|C4ZR48|MIAA_ECOBW tRNA dimethylallyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|B7M8T1|MIAA_ECO8A tRNA dimethylallyltransferase OS=Escherichia coli O8 (strain IAI1) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|B7LC30|MIAA_ECO55 tRNA dimethylallyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|A7ZV40|MIAA_ECO24 tRNA dimethylallyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=miaA PE=3 SV=1 52 395 6.0E-24
sp|Q1QY27|MIAA_CHRSD tRNA dimethylallyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=miaA PE=3 SV=1 48 375 6.0E-24
sp|A2C585|MIAA_PROM1 tRNA dimethylallyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=miaA PE=3 SV=1 47 380 6.0E-24
sp|B7LLV3|MIAA_ESCF3 tRNA dimethylallyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=miaA PE=3 SV=1 52 395 7.0E-24
sp|B1LQJ1|MIAA_ECOSM tRNA dimethylallyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=miaA PE=3 SV=1 52 395 7.0E-24
sp|B7NGA5|MIAA_ECOLU tRNA dimethylallyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=miaA PE=3 SV=1 52 395 7.0E-24
sp|B7NTM7|MIAA_ECO7I tRNA dimethylallyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=miaA PE=3 SV=1 52 395 7.0E-24
sp|Q6N874|MIAA_RHOPA tRNA dimethylallyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=miaA PE=3 SV=1 52 395 7.0E-24
sp|P74040|MIAA_SYNY3 tRNA dimethylallyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=miaA PE=3 SV=1 50 404 7.0E-24
sp|A1V0V9|MIAA_BURMS tRNA dimethylallyltransferase OS=Burkholderia mallei (strain SAVP1) GN=miaA PE=3 SV=1 51 361 8.0E-24
sp|Q62HE6|MIAA_BURMA tRNA dimethylallyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=miaA PE=3 SV=1 51 361 8.0E-24
sp|A2S552|MIAA_BURM9 tRNA dimethylallyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=miaA PE=3 SV=1 51 361 8.0E-24
sp|A3MN86|MIAA_BURM7 tRNA dimethylallyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=miaA PE=3 SV=1 51 361 8.0E-24
sp|Q820E1|MIAA_CHLCV tRNA dimethylallyltransferase OS=Chlamydophila caviae (strain GPIC) GN=miaA PE=3 SV=1 51 361 8.0E-24
sp|A3N3P8|MIAA_ACTP2 tRNA dimethylallyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=miaA PE=3 SV=1 55 361 8.0E-24
sp|Q0T9M2|MIAA_ECOL5 tRNA dimethylallyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=miaA PE=3 SV=1 52 395 9.0E-24
sp|Q48P03|MIAA_PSE14 tRNA dimethylallyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=miaA PE=3 SV=1 50 377 9.0E-24
sp|A4YZB3|MIAA_BRASO tRNA dimethylallyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=miaA PE=3 SV=1 52 379 1.0E-23
sp|A4W5R2|MIAA_ENT38 tRNA dimethylallyltransferase OS=Enterobacter sp. (strain 638) GN=miaA PE=3 SV=1 52 374 1.0E-23
sp|Q0HMP0|MIAA_SHESM tRNA dimethylallyltransferase OS=Shewanella sp. (strain MR-4) GN=miaA PE=3 SV=1 55 368 1.0E-23
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1866
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2732
Ophiocordyceps australis map64 (Brazil) OphauB2|6864
Ophiocordyceps camponoti-floridani Ophcf2|03543
Ophiocordyceps camponoti-rufipedis Ophun1|1862 (this protein)
Ophiocordyceps kimflemingae Ophio5|745
Ophiocordyceps subramaniannii Hirsu2|1898

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1862
MLRLLARLVSQSRITVASAMADCAPKMTACAPPTTTASSTTAARSPPTEPLIVVLGSTGTGKSDLALELASRFNG
EVINADAMQLYDGLPILTNKMPVSAQRGIRHHLLGHISPLDPPWNVDVFKREASRAVADIRSRGKLPILVGGTHY
YLDALLFPDVLLDTVRHEDQGNDAVPHHHYPLLDQPTDVLLAELRKCDPIMADRWHPNDRRKIQRSLEIFLSTGR
PASDFYAEQEQRRSAAIQHQHHHDHHPWDKLLLWVHADREPLCRRLDRRVDAMLQAGLLDEVRQLYHLRRNAPRP
YDMTKGIWQSIGYRQFEPYLDALLDTVPAPTSSLPALKTAALEGVKAATRRYASHQTRWIRWKQMRRLRHQGPDA
VSSLYLVDSTEPDLFRDRVLDPAAELVSLFLRGEPRPLPTDLSPCARHVLSAAWDSPTPEVRRKRTCDVCQITLL
TEEAWQRHVRGKNHRRVLRKRKMLELVPYEAPEQRPQSPSQDGSSSPEIASLF*
Coding >Ophun1|1862
ATGCTACGTCTTCTGGCCCGCCTCGTCTCGCAGTCTCGCATCACTGTCGCGTCTGCCATGGCGGACTGCGCCCCG
AAGATGACGGCCTGCGCTCCCCCTACGACGACAGCCTCTTCTACGACAGCAGCCCGCAGTCCACCCACAGAACCC
CTCATCGTCGTCCTCGGCTCAACCGGCACAGGCAAGTCCGACCTCGCCCTCGAGCTCGCCTCCCGCTTCAACGGC
GAAGTCATCAACGCCGACGCAATGCAACTCTACGACGGCCTCCCCATCCTCACCAACAAGATGCCCGTCTCGGCC
CAGCGCGGCATCAGACATCACCTCCTCGGCCACATCTCTCCTCTCGACCCGCCATGGAACGTCGACGTCTTTAAG
CGCGAAGCTTCGCGTGCCGTCGCTGATATTCGCTCCCGTGGCAAGCTTCCCATTCTCGTCGGCGGCACGCACTAC
TATCTCGACGCCTTGCTCTTCCCAGACGTCTTGCTCGACACCGTCCGACACGAAGACCAAGGCAATGATGCCGTC
CCCCATCATCACTACCCCCTCCTCGACCAACCAACCGACGTCCTCCTCGCCGAACTCCGCAAATGCGATCCCATA
ATGGCCGACCGCTGGCACCCCAATGACCGCCGCAAGATTCAACGCTCCCTCGAGATCTTCCTCTCCACCGGCCGT
CCCGCCTCAGACTTCTACGCCGAGCAGGAACAGCGCCGCAGCGCCGCCATCCAACACCAGCATCACCATGACCAC
CACCCCTGGGACAAGCTCCTCCTCTGGGTCCACGCCGACCGCGAACCCCTCTGCCGCCGCCTCGACCGCCGCGTT
GACGCCATGCTCCAAGCCGGTCTCCTCGACGAAGTCCGCCAGCTATACCATCTCCGCCGTAACGCCCCTCGTCCC
TACGACATGACAAAGGGCATCTGGCAATCCATCGGCTACCGCCAGTTCGAGCCCTACCTCGACGCCCTTCTCGAC
ACCGTCCCCGCGCCCACCTCCTCCCTCCCCGCCCTAAAGACAGCCGCGCTCGAGGGCGTCAAGGCCGCCACCCGC
CGCTACGCCTCCCACCAGACGCGCTGGATCCGCTGGAAGCAGATGCGCCGCCTCCGCCATCAGGGCCCGGACGCC
GTGTCCAGCCTCTACCTCGTCGACAGCACCGAACCGGACCTCTTCCGCGACCGCGTCCTCGACCCGGCCGCCGAG
CTCGTCTCCCTCTTCCTCCGAGGCGAGCCTCGTCCTCTCCCCACGGACCTATCTCCCTGTGCTCGCCACGTCCTC
TCAGCAGCCTGGGACTCCCCAACGCCCGAGGTCCGGCGAAAACGCACCTGCGACGTCTGCCAGATAACGCTCCTG
ACAGAAGAGGCCTGGCAGAGACATGTGCGCGGCAAAAATCATCGGCGCGTGCTAAGAAAGAGAAAGATGCTGGAG
CTTGTGCCGTACGAGGCACCGGAGCAGAGGCCGCAGTCGCCGTCTCAAGACGGCTCTTCTAGTCCCGAGATTGCC
TCTCTGTTCTGA
Transcript >Ophun1|1862
ATGCTACGTCTTCTGGCCCGCCTCGTCTCGCAGTCTCGCATCACTGTCGCGTCTGCCATGGCGGACTGCGCCCCG
AAGATGACGGCCTGCGCTCCCCCTACGACGACAGCCTCTTCTACGACAGCAGCCCGCAGTCCACCCACAGAACCC
CTCATCGTCGTCCTCGGCTCAACCGGCACAGGCAAGTCCGACCTCGCCCTCGAGCTCGCCTCCCGCTTCAACGGC
GAAGTCATCAACGCCGACGCAATGCAACTCTACGACGGCCTCCCCATCCTCACCAACAAGATGCCCGTCTCGGCC
CAGCGCGGCATCAGACATCACCTCCTCGGCCACATCTCTCCTCTCGACCCGCCATGGAACGTCGACGTCTTTAAG
CGCGAAGCTTCGCGTGCCGTCGCTGATATTCGCTCCCGTGGCAAGCTTCCCATTCTCGTCGGCGGCACGCACTAC
TATCTCGACGCCTTGCTCTTCCCAGACGTCTTGCTCGACACCGTCCGACACGAAGACCAAGGCAATGATGCCGTC
CCCCATCATCACTACCCCCTCCTCGACCAACCAACCGACGTCCTCCTCGCCGAACTCCGCAAATGCGATCCCATA
ATGGCCGACCGCTGGCACCCCAATGACCGCCGCAAGATTCAACGCTCCCTCGAGATCTTCCTCTCCACCGGCCGT
CCCGCCTCAGACTTCTACGCCGAGCAGGAACAGCGCCGCAGCGCCGCCATCCAACACCAGCATCACCATGACCAC
CACCCCTGGGACAAGCTCCTCCTCTGGGTCCACGCCGACCGCGAACCCCTCTGCCGCCGCCTCGACCGCCGCGTT
GACGCCATGCTCCAAGCCGGTCTCCTCGACGAAGTCCGCCAGCTATACCATCTCCGCCGTAACGCCCCTCGTCCC
TACGACATGACAAAGGGCATCTGGCAATCCATCGGCTACCGCCAGTTCGAGCCCTACCTCGACGCCCTTCTCGAC
ACCGTCCCCGCGCCCACCTCCTCCCTCCCCGCCCTAAAGACAGCCGCGCTCGAGGGCGTCAAGGCCGCCACCCGC
CGCTACGCCTCCCACCAGACGCGCTGGATCCGCTGGAAGCAGATGCGCCGCCTCCGCCATCAGGGCCCGGACGCC
GTGTCCAGCCTCTACCTCGTCGACAGCACCGAACCGGACCTCTTCCGCGACCGCGTCCTCGACCCGGCCGCCGAG
CTCGTCTCCCTCTTCCTCCGAGGCGAGCCTCGTCCTCTCCCCACGGACCTATCTCCCTGTGCTCGCCACGTCCTC
TCAGCAGCCTGGGACTCCCCAACGCCCGAGGTCCGGCGAAAACGCACCTGCGACGTCTGCCAGATAACGCTCCTG
ACAGAAGAGGCCTGGCAGAGACATGTGCGCGGCAAAAATCATCGGCGCGTGCTAAGAAAGAGAAAGATGCTGGAG
CTTGTGCCGTACGAGGCACCGGAGCAGAGGCCGCAGTCGCCGTCTCAAGACGGCTCTTCTAGTCCCGAGATTGCC
TCTCTGTTCTGA
Gene >Ophun1|1862
ATGCTACGTCTTCTGGCCCGCCTCGTCTCGCAGTCTCGCATCACTGTCGCGTCTGCCATGGCGGACTGCGCCCCG
AAGATGACGGCCTGCGCTCCCCCTACGACGACAGCCTCTTCTACGACAGCAGCCCGCAGTCCACCCACAGAACCC
CTCATCGTCGTCCTCGGCTCAACCGGCACAGGCAAGTCCGACGTCCGTCCCCCTCCTCTCCCCCGAACCCATCCC
CACGCCAACCTTCCTCCCTCCAGCTCGCCCTCGAGCTCGCCTCCCGCTTCAACGGCGAAGTCATCAACGCCGACG
CAATGCAACTCTACGACGGCCTCCCCATCCTCACCAACAAGATGCCCGTCTCGGCCCAGCGCGGCATCAGACATC
ACCTCCTCGGCCACATCTCTCCTCTCGACCCGCCATGGAACGTCGACGTCTTTAAGCGCGAAGCTTCGCGTGCCG
TCGCTGATATTCGCTCCCGTGGCAAGCTTCCCATTCTCGTCGGCGGCACGCACTACTATCTCGACGCCTTGCTCT
TCCCAGACGTCTTGCTCGACACCGTCCGACACGAAGACCAAGGCAATGATGCCGTCCCCCATCATCACTACCCCC
TCCTCGACCAACCAACCGACGTCCTCCTCGCCGAACTCCGCAAATGCGATCCCATAATGGCCGACCGCTGGCACC
CCAATGACCGCCGCAAGATTCAACGCTCCCTCGAGATCTTCCTCTCCACCGGCCGTCCCGCCTCAGACTTCTACG
CCGAGCAGGAACAGCGCCGCAGCGCCGCCATCCAACACCAGCATCACCATGACCACCACCCCTGGGACAAGCTCC
TCCTCTGGGTCCACGCCGACCGCGAACCCCTCTGCCGCCGCCTCGACCGCCGCGTTGACGCCATGCTCCAAGCCG
GTCTCCTCGACGAAGTCCGCCAGCTATACCATCTCCGCCGTAACGCCCCTCGTCCCTACGACATGACAAAGGGCA
TCTGGCAATCCATCGGCTACCGCCAGTTCGAGCCCTACCTCGACGCCCTTCTCGACACCGTCCCCGCGCCCACCT
CCTCCCTCCCCGCCCTAAAGACAGCCGCGCTCGAGGGCGTCAAGGCCGCCACCCGCCGCTACGCCTCCCACCAGA
CGCGCTGGATCCGCTGGAAGCAGATGCGCCGCCTCCGCCATCAGGGCCCGGACGCCGTGTCCAGCCTCTACCTCG
TCGACAGCACCGAACCGGACCTCTTCCGCGACCGCGTCCTCGACCCGGCCGCCGAGCTCGTCTCCCTCTTCCTCC
GAGGCGAGCCTCGTCCTCTCCCCACGGACCTATCTCCCTGTGCTCGCCACGTCCTCTCAGCAGCCTGGGACTCCC
CAACGCCCGAGGTCCGGCGAAAACGCACCTGCGACGTCTGCCAGATAACGCTCCTGACAGAAGAGGCCTGGCAGA
GACATGTGCGCGGCAAAAATCATCGGCGCGTGCTAAGAAAGAGAAAGATGCTGGAGCTTGTGCCGTACGAGGCAC
CGGAGCAGAGGCCGCAGTCGCCGTCTCAAGACGGCTCTTCTAGTCCCGAGATTGCCTCTCTGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail