Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1856
Gene name
LocationContig_182:5941..7886
Strand-
Gene length (bp)1945
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.4E-26 93 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 23 541 6.0E-65
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 26 533 4.0E-45
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 57 461 1.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 57 461 1.0E-21
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 25 477 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 23 541 6.0E-65
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 26 533 4.0E-45
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 57 461 1.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 57 461 1.0E-21
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 25 477 4.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 8 532 1.0E-19
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 39 527 8.0E-17
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 57 525 1.0E-13
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 6 528 2.0E-13
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 57 461 5.0E-13
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 57 528 9.0E-13
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 3 539 2.0E-12
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 124 532 2.0E-11
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 3 528 2.0E-11
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 57 536 7.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 44 476 8.0E-11
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 9 480 9.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 11 532 2.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 129 249 1.0E-09
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 309 522 2.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 97 527 2.0E-08
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 26 528 5.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 57 445 4.0E-07
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 57 445 4.0E-07
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 45 461 6.0E-06
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 321 504 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 138 155 17
3 197 219 22
4 224 246 22
5 320 342 22
6 362 384 22
7 404 426 22
8 436 458 22
9 465 487 22
10 497 519 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1856
MDRYRRDSSTTQSVDEESAVTLDALENHPPGTVNLVSKLQVAGKEEKLRLVPQPSGDPNDPLGWPLWRKICNFAL
LASMTTSIYSGLSMQHLFWSRMKKELHVDYTQLTHAKAAQLAAEALACVVFIPFAKKYGRRPIYIISTMLFTAAT
WWSGYMTTKAELFIIDIIKGFAGAVNETAVQMSIRDMFFVHQRGRANGFYLVALTTGISFSPLAAGAQAKTYGWR
ASFKTLAAVMTGITVLFFFLFEETKFVPAATRSTGEAYDKEATTSGEFSSGDSTLDLARQEPAKKARYPRNMRLQ
LVTPTNESLWQTLFEPFQACRLPHVVIIGLLYGLGLAYVVMVGSMKSIIFPEAPYNFDPEQLGLLQLGPFVGSTL
AGLYGGMLSDKAIIWFAKRNKGVFEPEMRLYLLPLPVVLMSAGIATFGVTAGQGMHWIYPVIGSTMTSFGFNSSA
DLILTVIIDAYPDIISQSFVVIAFLRNFLGMLGVLSLTPWREHMGVIYMFIIIAVLAFVVNCLAIPLVIWGKKLR
AKTAPRYYRMMRAESH*
Coding >Ophun1|1856
ATGGACCGCTACCGCAGAGACTCGTCGACGACTCAGTCCGTCGACGAGGAGAGCGCCGTGACTCTGGATGCGCTG
GAAAACCACCCGCCCGGGACCGTCAATCTGGTTTCCAAGCTTCAAGTGGCAGGCAAAGAGGAAAAACTGAGGCTG
GTCCCACAGCCTTCGGGTGACCCAAACGACCCCCTGGGTTGGCCCCTCTGGCGCAAGATCTGCAACTTTGCCCTT
CTCGCCTCCATGACAACCTCCATCTACTCGGGGCTTTCGATGCAGCACTTGTTCTGGTCTCGGATGAAGAAGGAG
CTTCATGTCGACTATACGCAACTGACTCACGCCAAGGCTGCCCAGCTCGCGGCCGAGGCCCTGGCGTGTGTCGTC
TTCATCCCATTCGCCAAGAAGTACGGCCGGCGTCCGATATACATCATTTCGACAATGCTGTTCACCGCCGCTACC
TGGTGGTCGGGTTATATGACGACGAAGGCGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCCGGAGCCGTC
AACGAGACGGCCGTGCAGATGAGCATCCGTGACATGTTCTTTGTCCATCAGAGAGGTAGAGCCAACGGCTTCTAT
CTGGTTGCCCTAACGACGGGCATCTCGTTCAGTCCCTTGGCAGCCGGCGCCCAGGCAAAGACCTATGGCTGGAGG
GCATCGTTCAAGACGCTCGCCGCCGTCATGACGGGCATCACCGTCTTGTTCTTCTTTCTTTTCGAGGAGACCAAG
TTTGTTCCCGCCGCGACTCGCTCGACTGGAGAAGCATACGACAAAGAGGCGACCACCAGCGGCGAATTCTCATCC
GGGGACAGCACCCTCGACTTGGCGAGACAGGAACCAGCCAAGAAGGCTCGGTATCCGCGCAACATGAGGCTTCAG
CTCGTGACGCCGACCAACGAGTCGCTGTGGCAGACTTTGTTCGAGCCGTTTCAAGCTTGCCGCTTGCCTCACGTC
GTCATCATCGGTTTGCTCTACGGGCTGGGTCTGGCATACGTCGTCATGGTGGGCTCCATGAAGTCCATCATTTTC
CCTGAAGCGCCGTACAACTTTGACCCGGAGCAGCTCGGGCTGCTGCAGCTGGGCCCGTTTGTTGGATCGACGTTG
GCTGGCCTGTACGGAGGCATGCTATCGGACAAGGCCATCATCTGGTTCGCCAAGCGGAACAAGGGCGTCTTCGAG
CCGGAGATGCGCTTGTACCTGCTGCCATTGCCAGTCGTCCTCATGTCTGCTGGTATTGCAACCTTTGGAGTTACG
GCCGGTCAGGGCATGCACTGGATCTACCCGGTCATAGGCAGCACCATGACATCTTTTGGCTTCAATTCGTCGGCG
GATCTCATACTGACGGTGATTATCGATGCGTATCCGGACATCATCTCGCAATCCTTTGTCGTCATCGCCTTCCTC
CGCAACTTTCTCGGTATGTTGGGCGTGCTATCCCTGACACCGTGGCGCGAGCACATGGGCGTCATCTACATGTTC
ATCATCATCGCGGTGCTCGCCTTCGTCGTCAACTGCCTCGCCATTCCGCTCGTCATCTGGGGCAAGAAGCTCAGG
GCCAAGACGGCGCCGCGATACTACCGGATGATGAGGGCCGAGTCGCACTGA
Transcript >Ophun1|1856
ATGGACCGCTACCGCAGAGACTCGTCGACGACTCAGTCCGTCGACGAGGAGAGCGCCGTGACTCTGGATGCGCTG
GAAAACCACCCGCCCGGGACCGTCAATCTGGTTTCCAAGCTTCAAGTGGCAGGCAAAGAGGAAAAACTGAGGCTG
GTCCCACAGCCTTCGGGTGACCCAAACGACCCCCTGGGTTGGCCCCTCTGGCGCAAGATCTGCAACTTTGCCCTT
CTCGCCTCCATGACAACCTCCATCTACTCGGGGCTTTCGATGCAGCACTTGTTCTGGTCTCGGATGAAGAAGGAG
CTTCATGTCGACTATACGCAACTGACTCACGCCAAGGCTGCCCAGCTCGCGGCCGAGGCCCTGGCGTGTGTCGTC
TTCATCCCATTCGCCAAGAAGTACGGCCGGCGTCCGATATACATCATTTCGACAATGCTGTTCACCGCCGCTACC
TGGTGGTCGGGTTATATGACGACGAAGGCGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCCGGAGCCGTC
AACGAGACGGCCGTGCAGATGAGCATCCGTGACATGTTCTTTGTCCATCAGAGAGGTAGAGCCAACGGCTTCTAT
CTGGTTGCCCTAACGACGGGCATCTCGTTCAGTCCCTTGGCAGCCGGCGCCCAGGCAAAGACCTATGGCTGGAGG
GCATCGTTCAAGACGCTCGCCGCCGTCATGACGGGCATCACCGTCTTGTTCTTCTTTCTTTTCGAGGAGACCAAG
TTTGTTCCCGCCGCGACTCGCTCGACTGGAGAAGCATACGACAAAGAGGCGACCACCAGCGGCGAATTCTCATCC
GGGGACAGCACCCTCGACTTGGCGAGACAGGAACCAGCCAAGAAGGCTCGGTATCCGCGCAACATGAGGCTTCAG
CTCGTGACGCCGACCAACGAGTCGCTGTGGCAGACTTTGTTCGAGCCGTTTCAAGCTTGCCGCTTGCCTCACGTC
GTCATCATCGGTTTGCTCTACGGGCTGGGTCTGGCATACGTCGTCATGGTGGGCTCCATGAAGTCCATCATTTTC
CCTGAAGCGCCGTACAACTTTGACCCGGAGCAGCTCGGGCTGCTGCAGCTGGGCCCGTTTGTTGGATCGACGTTG
GCTGGCCTGTACGGAGGCATGCTATCGGACAAGGCCATCATCTGGTTCGCCAAGCGGAACAAGGGCGTCTTCGAG
CCGGAGATGCGCTTGTACCTGCTGCCATTGCCAGTCGTCCTCATGTCTGCTGGTATTGCAACCTTTGGAGTTACG
GCCGGTCAGGGCATGCACTGGATCTACCCGGTCATAGGCAGCACCATGACATCTTTTGGCTTCAATTCGTCGGCG
GATCTCATACTGACGGTGATTATCGATGCGTATCCGGACATCATCTCGCAATCCTTTGTCGTCATCGCCTTCCTC
CGCAACTTTCTCGGTATGTTGGGCGTGCTATCCCTGACACCGTGGCGCGAGCACATGGGCGTCATCTACATGTTC
ATCATCATCGCGGTGCTCGCCTTCGTCGTCAACTGCCTCGCCATTCCGCTCGTCATCTGGGGCAAGAAGCTCAGG
GCCAAGACGGCGCCGCGATACTACCGGATGATGAGGGCCGAGTCGCACTGA
Gene >Ophun1|1856
ATGGACCGCTACCGCAGAGACTCGTCGACGACTCAGTCCGTCGACGAGGAGAGCGCCGTGACTCTGGATGCGCTG
GAAAACCACCCGCCCGGGACCGTCAATCTGGTTTCCAGTATGCAGCCACGCTTCCTTCTCCATCAGACTCTCTGT
TAACCGCTTCTCCAGAGCTTCAAGTGGCAGGCAAAGAGGAAAAACTGAGGCTGGTCCCACAGCCTTCGGGTGACC
CAAACGACCCCCTGGTGAGTCTTGTTCGACCGAGTTGCAGCCGGGTGTCGCTGACTGCTGCTTCCAGGGTTGGCC
CCTCTGGCGCAAGATCTGCAACTTTGCCCTTCTCGCCTCCATGACAACCTCCATCTACTCGGGGTAGGTTCAGTT
CCGTCATTCTGTCCGACTCGACGCTGAGACGACGACAGGCTTTCGATGCAGCACTTGTTCTGGTCTCGGATGAAG
AAGGAGCTTCATGTCGACTATACGCAACTGACTCACGCCAAGGCTGCCCAGCTCGCGGCCGAGGCCCTGGCGTGT
GTCGTCTTCATCCCATTCGCCAAGAAGTACGGCCGGCGTCCGATATACATCATTTCGACAATGCTGTTCACCGCC
GCTACCTGGTGGTCGGGTTATATGACGACGAAGGCGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCCGGA
GCCGTCAACGAGACGGCCGTGCAGATGAGCGTACGTTACCACTGCAAGTCTGTGCTCGCTTCTGAACGCTGACCC
GGATTGCAGATCCGTGACATGTTCTTTGTCCATCAGAGAGGTAGAGCCAACGGCTTCTATCTGGTTGCCCTAACG
ACGGGCATCTCGTTCAGTCCCTTGGCAGCCGGCGCCCAGGCAAAGACCTATGGCTGGAGGGCATCGTTCAAGACG
CTCGCCGCCGTCATGACGGGCATCACCGTCTTGTTCTTCTTTCTTTTCGAGGAGACCAAGTTTGTTCCCGCCGCG
ACTCGCTCGACTGGAGAAGCATACGACAAAGAGGCGACCACCAGCGGCGAATTCTCATCCGGGGACAGCACCCTC
GACTTGGCGAGACAGGAACCAGCCAAGAAGGCTCGGTATCCGCGCAACATGAGGCTTCAGCTCGTGACGCCGACC
AACGAGTCGCTGTGGCAGACTTTGTTCGAGCCGTTTCAAGCTTGCCGCTTGCCTCACGTCGTCATCATCGGTTTG
CTCTACGGGCTGGGTCTGGCATACGTCGTCATGGTGGGCTCCATGAAGTCCATCATTTTCCCTGAAGCGCCGTAC
AACTTTGACCCGGAGCAGCTCGGGCTGCTGCAGCTGGGCCCGTTTGTTGGATCGACGTTGGCTGGCCTGTACGGA
GGCATGCTATCGGACAAGGCCATCATCTGGTTCGCCAAGCGGAACAAGGGCGTCTTCGAGCCGGAGATGCGCTTG
TACCTGCTGCCATTGCCAGTCGTCCTCATGTCTGCTGGTATTGCAACCTTTGGAGTTACGGCCGGTCAGGTAAGT
GACGATGCCTATCTCGGGTAGGGTAGAGCCGTCAACTGACGATACGGAAGGGCATGCACTGGATCTACCCGGTCA
TAGGCAGCACCATGACATCTTTTGGCTTCAATTCGTCGGCGGATCTCATACTGACGGTGATTATCGATGCGTATC
CGGACGTGAGTATTTCCTCAATCGGCATCCAACCGATGGAGCGCTCACAGGTCTTCAGATCATCTCGCAATCCTT
TGTCGTCATCGCCTTCCTCCGCAACTTTCTCGGTATGTTGGGCGTGCTATCCCTGACACCGTGGCGCGAGCACAT
GGGCGTCATCTACATGTTCATCATCATCGCGGTGCTCGCCTTCGTCGTCAACTGCCTCGCCATTCCGCTCGTCAT
CTGGGGCAAGAAGCTCAGGGCCAAGACGGCGCCGCGATACTACCGGATGATGAGGGCCGAGTCGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail