Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|185
Gene name
LocationContig_103:17826..20345
Strand-
Gene length (bp)2519
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09511 RNA_lig_T4_1 RNA ligase 1.3E-87 92 325
PF08302 tRNA_lig_CPD Fungal tRNA ligase phosphodiesterase domain 6.0E-64 583 807
PF08303 tRNA_lig_kinase tRNA ligase kinase domain 1.5E-50 423 580

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10313|TRNL_SCHPO tRNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trl1 PE=3 SV=2 66 808 3.0E-164
sp|P09880|TRNL_YEAST tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRL1 PE=1 SV=1 35 779 1.0E-154
sp|P43075|TRNL_CANAL tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG1 PE=3 SV=2 68 762 5.0E-123

GO

GO Term Description Terminal node
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0005524 ATP binding Yes
GO:0003972 RNA ligase (ATP) activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0140098 catalytic activity, acting on RNA No
GO:0008380 RNA splicing No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0008452 RNA ligase activity No
GO:0034470 ncRNA processing No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0000166 nucleotide binding No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0008033 tRNA processing No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4406
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|408
Ophiocordyceps australis map64 (Brazil) OphauB2|8069
Ophiocordyceps camponoti-floridani Ophcf2|00096
Ophiocordyceps camponoti-rufipedis Ophun1|185 (this protein)
Ophiocordyceps kimflemingae Ophio5|4543
Ophiocordyceps subramaniannii Hirsu2|9119

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|185
MAESAMATTPPNEPQHMPGVVRSLATARASSTIQDGADLVKVLEEQLTRKTKKASYHIRRTSHHVKDSRDNIKVH
SWRFPDHEYKRASLPTNARGLFTTKKKDGTHEIVVRGYDKFFNVGEVSHTKWDSIIAKTKPPYDLTLKENGCIIF
IGGLEDGTLLVCSKHSTGEREGVLSHAKAGEAHLEKQLSALGKTKEEFARELRERNVTAVAELCDDSFEEHILAY
SPEDAGLYLHGVNKNEPIFGTYPSSEVQSFADQWGFRKIGVITMSDVHSVRTFLEEAAKTGSYQGRAVEGFVIRC
KMSKHPETLPYQDWFFKYKFDEPYLMYRQWREVTKQIIAGKDPVYKKNKLITGQYIKYARSRLAADPKLGEKFVL
NHGIIALRDDFLKFKNLEGSEAAAIQDPESGRQPKAGARLDEVDGNVVLCPVATIGCGKTTCGVALTKLFGWGHL
QNDNISGKNRPPRFLESVVSELKSRPVVFADRNNAEKRERAQLIDGLKAVKANAKVVCLNWVHDRGAMNDIRNVT
LSRVQNRGDNHQTIKAHSHSQKYEKIMDGFLQRYQACEPWTLPDSKFDLIIDLDPVVDSRVNLDKIIAHLHKWFP
KLVPAIPSEENVADAVGYAMTCRVQPQQAERPQKDGATTGNLEYMAVHVDAKAIYASLQQAFDSVDEKTRAFFAQ
LKQNKRVQDKFHVTLLHRASAKEHPELWKRYTEASEGISGENGKAGECGVILERVVFDDQVMAIVVRLIDSDQKW
ECANRVAHITVGTRDASIKPKQSNDLLARWLGEGLEGSQLTEVVFEPKPTIQGFVGPVRSRSNPPTKRK*
Coding >Ophun1|185
ATGGCCGAGTCGGCGATGGCGACAACGCCCCCCAATGAACCTCAACATATGCCCGGCGTGGTTCGATCTCTGGCC
ACTGCACGCGCATCCTCCACGATTCAAGATGGGGCCGACTTGGTGAAAGTCCTCGAAGAGCAATTGACTCGAAAG
ACGAAAAAAGCATCTTATCACATCAGAAGAACCTCGCACCACGTTAAAGATTCTCGCGATAATATCAAAGTGCAC
TCGTGGAGGTTTCCAGATCATGAATACAAAAGAGCTTCGTTGCCCACTAATGCGCGAGGTCTCTTTACGACCAAG
AAAAAGGATGGGACGCATGAGATTGTCGTCAGGGGTTACGACAAGTTCTTCAACGTTGGAGAGGTCTCACACACC
AAGTGGGACAGCATCATTGCTAAAACGAAGCCGCCGTACGATTTGACGCTCAAGGAAAACGGCTGCATCATCTTC
ATCGGTGGCCTTGAGGACGGAACCCTGCTCGTTTGCAGTAAGCACTCGACTGGAGAACGCGAGGGCGTCCTGAGT
CATGCCAAAGCCGGCGAGGCTCACTTGGAGAAGCAACTGTCAGCCCTTGGCAAGACGAAGGAGGAGTTCGCCCGA
GAGCTTCGCGAGAGGAATGTAACTGCTGTGGCCGAGCTCTGCGACGACTCATTCGAAGAGCATATCCTCGCGTAC
AGTCCAGAAGACGCTGGCCTATATCTTCACGGCGTCAACAAGAACGAGCCCATCTTCGGCACCTATCCTAGCTCT
GAAGTGCAAAGCTTTGCCGATCAGTGGGGTTTTCGCAAAATTGGAGTCATCACCATGAGCGACGTTCACTCTGTC
CGGACTTTCCTTGAAGAAGCGGCCAAGACAGGGTCTTATCAAGGCAGAGCCGTCGAAGGCTTCGTCATTCGCTGC
AAAATGAGCAAACACCCAGAAACCTTGCCCTACCAAGACTGGTTCTTCAAGTACAAGTTCGATGAGCCATATCTC
ATGTATCGGCAGTGGCGCGAGGTGACGAAACAGATCATCGCGGGCAAGGACCCCGTGTATAAGAAGAACAAGCTC
ATCACGGGACAATACATCAAATACGCTCGCTCCCGACTGGCCGCCGACCCGAAGCTCGGCGAGAAATTTGTGCTC
AACCATGGCATCATCGCCCTCCGCGACGACTTTCTCAAATTCAAGAACCTCGAGGGCTCCGAGGCTGCTGCGATA
CAAGACCCGGAATCGGGCCGGCAACCAAAGGCAGGTGCCCGTCTAGACGAAGTCGATGGAAACGTTGTCTTGTGT
CCGGTGGCGACCATTGGCTGCGGAAAGACGACGTGCGGCGTGGCGTTGACGAAACTGTTCGGCTGGGGCCATCTG
CAGAACGACAACATATCCGGCAAGAATCGCCCACCAAGGTTCTTAGAGTCTGTTGTCTCGGAGCTGAAATCGCGA
CCGGTCGTCTTCGCGGACCGCAACAACGCAGAGAAAAGAGAAAGAGCTCAGCTCATCGACGGTTTGAAGGCTGTC
AAAGCCAACGCCAAGGTGGTCTGCCTCAACTGGGTTCACGATCGTGGTGCGATGAACGACATTCGAAACGTGACC
CTGAGTAGGGTCCAGAACCGTGGTGATAACCACCAGACCATCAAGGCCCACTCGCATTCGCAAAAGTACGAGAAA
ATCATGGATGGCTTTTTGCAGCGCTATCAGGCATGTGAACCCTGGACTTTACCGGACTCCAAGTTCGACTTGATC
ATCGACCTGGATCCTGTGGTGGACTCGCGGGTCAATCTCGACAAGATAATCGCCCACCTTCACAAGTGGTTCCCG
AAATTGGTGCCGGCTATCCCATCGGAGGAGAACGTCGCGGATGCTGTGGGTTATGCGATGACATGCCGGGTGCAA
CCGCAACAAGCAGAACGCCCTCAGAAAGATGGGGCTACGACTGGCAACTTGGAGTATATGGCTGTGCATGTTGAT
GCCAAAGCCATCTACGCATCTCTTCAACAGGCTTTCGACTCGGTCGACGAGAAGACTCGGGCCTTCTTTGCGCAG
CTGAAGCAGAATAAAAGAGTGCAAGATAAGTTTCACGTCACGCTCTTGCATCGGGCATCGGCCAAAGAGCACCCG
GAGCTGTGGAAGAGATATACGGAGGCTTCCGAAGGCATCTCTGGGGAAAATGGCAAAGCCGGCGAATGTGGAGTG
ATACTGGAACGGGTTGTATTTGATGACCAGGTCATGGCCATTGTGGTCCGGCTGATAGACAGTGACCAGAAGTGG
GAGTGTGCGAACCGCGTGGCTCACATCACAGTCGGCACTCGAGATGCAAGCATCAAGCCCAAGCAAAGCAACGAC
CTGTTAGCTAGGTGGCTGGGCGAGGGCCTCGAGGGTAGCCAGTTGACCGAGGTCGTCTTTGAGCCGAAGCCGACG
ATTCAAGGCTTTGTCGGGCCGGTGCGCTCCAGGAGTAATCCGCCTACTAAAAGGAAGTAG
Transcript >Ophun1|185
ATGGCCGAGTCGGCGATGGCGACAACGCCCCCCAATGAACCTCAACATATGCCCGGCGTGGTTCGATCTCTGGCC
ACTGCACGCGCATCCTCCACGATTCAAGATGGGGCCGACTTGGTGAAAGTCCTCGAAGAGCAATTGACTCGAAAG
ACGAAAAAAGCATCTTATCACATCAGAAGAACCTCGCACCACGTTAAAGATTCTCGCGATAATATCAAAGTGCAC
TCGTGGAGGTTTCCAGATCATGAATACAAAAGAGCTTCGTTGCCCACTAATGCGCGAGGTCTCTTTACGACCAAG
AAAAAGGATGGGACGCATGAGATTGTCGTCAGGGGTTACGACAAGTTCTTCAACGTTGGAGAGGTCTCACACACC
AAGTGGGACAGCATCATTGCTAAAACGAAGCCGCCGTACGATTTGACGCTCAAGGAAAACGGCTGCATCATCTTC
ATCGGTGGCCTTGAGGACGGAACCCTGCTCGTTTGCAGTAAGCACTCGACTGGAGAACGCGAGGGCGTCCTGAGT
CATGCCAAAGCCGGCGAGGCTCACTTGGAGAAGCAACTGTCAGCCCTTGGCAAGACGAAGGAGGAGTTCGCCCGA
GAGCTTCGCGAGAGGAATGTAACTGCTGTGGCCGAGCTCTGCGACGACTCATTCGAAGAGCATATCCTCGCGTAC
AGTCCAGAAGACGCTGGCCTATATCTTCACGGCGTCAACAAGAACGAGCCCATCTTCGGCACCTATCCTAGCTCT
GAAGTGCAAAGCTTTGCCGATCAGTGGGGTTTTCGCAAAATTGGAGTCATCACCATGAGCGACGTTCACTCTGTC
CGGACTTTCCTTGAAGAAGCGGCCAAGACAGGGTCTTATCAAGGCAGAGCCGTCGAAGGCTTCGTCATTCGCTGC
AAAATGAGCAAACACCCAGAAACCTTGCCCTACCAAGACTGGTTCTTCAAGTACAAGTTCGATGAGCCATATCTC
ATGTATCGGCAGTGGCGCGAGGTGACGAAACAGATCATCGCGGGCAAGGACCCCGTGTATAAGAAGAACAAGCTC
ATCACGGGACAATACATCAAATACGCTCGCTCCCGACTGGCCGCCGACCCGAAGCTCGGCGAGAAATTTGTGCTC
AACCATGGCATCATCGCCCTCCGCGACGACTTTCTCAAATTCAAGAACCTCGAGGGCTCCGAGGCTGCTGCGATA
CAAGACCCGGAATCGGGCCGGCAACCAAAGGCAGGTGCCCGTCTAGACGAAGTCGATGGAAACGTTGTCTTGTGT
CCGGTGGCGACCATTGGCTGCGGAAAGACGACGTGCGGCGTGGCGTTGACGAAACTGTTCGGCTGGGGCCATCTG
CAGAACGACAACATATCCGGCAAGAATCGCCCACCAAGGTTCTTAGAGTCTGTTGTCTCGGAGCTGAAATCGCGA
CCGGTCGTCTTCGCGGACCGCAACAACGCAGAGAAAAGAGAAAGAGCTCAGCTCATCGACGGTTTGAAGGCTGTC
AAAGCCAACGCCAAGGTGGTCTGCCTCAACTGGGTTCACGATCGTGGTGCGATGAACGACATTCGAAACGTGACC
CTGAGTAGGGTCCAGAACCGTGGTGATAACCACCAGACCATCAAGGCCCACTCGCATTCGCAAAAGTACGAGAAA
ATCATGGATGGCTTTTTGCAGCGCTATCAGGCATGTGAACCCTGGACTTTACCGGACTCCAAGTTCGACTTGATC
ATCGACCTGGATCCTGTGGTGGACTCGCGGGTCAATCTCGACAAGATAATCGCCCACCTTCACAAGTGGTTCCCG
AAATTGGTGCCGGCTATCCCATCGGAGGAGAACGTCGCGGATGCTGTGGGTTATGCGATGACATGCCGGGTGCAA
CCGCAACAAGCAGAACGCCCTCAGAAAGATGGGGCTACGACTGGCAACTTGGAGTATATGGCTGTGCATGTTGAT
GCCAAAGCCATCTACGCATCTCTTCAACAGGCTTTCGACTCGGTCGACGAGAAGACTCGGGCCTTCTTTGCGCAG
CTGAAGCAGAATAAAAGAGTGCAAGATAAGTTTCACGTCACGCTCTTGCATCGGGCATCGGCCAAAGAGCACCCG
GAGCTGTGGAAGAGATATACGGAGGCTTCCGAAGGCATCTCTGGGGAAAATGGCAAAGCCGGCGAATGTGGAGTG
ATACTGGAACGGGTTGTATTTGATGACCAGGTCATGGCCATTGTGGTCCGGCTGATAGACAGTGACCAGAAGTGG
GAGTGTGCGAACCGCGTGGCTCACATCACAGTCGGCACTCGAGATGCAAGCATCAAGCCCAAGCAAAGCAACGAC
CTGTTAGCTAGGTGGCTGGGCGAGGGCCTCGAGGGTAGCCAGTTGACCGAGGTCGTCTTTGAGCCGAAGCCGACG
ATTCAAGGCTTTGTCGGGCCGGTGCGCTCCAGGAGTAATCCGCCTACTAAAAGGAAGTAG
Gene >Ophun1|185
ATGGCCGAGTCGGCGATGGCGACAACGCCCCCCAATGAACCTCAACATATGCCCGGCGTGGTTCGATCTCTGGCC
ACTGCACGCGCATCCTCCACGATTCAAGATGGGGCCGACTTGGTGAAAGTCCTCGAAGAGCAATTGACTCGAAAG
ACGAAAAAAGCATCTTATCACATCAGAAGAACCTCGCACCACGTTAAAGATTCTCGCGATAATATCAAAGTGCAC
TCGTGGAGGTTTCCAGATCATGAATACAAAAGAGCTTCGTTGCCCACTAATGCGCGAGGTCTCTTTACGACCAAG
AAAAAGGATGGGACGCATGAGATTGTCGTCAGGGGTTACGACAAGTTCTTCAACGTTGGAGAGGTCTCACACACC
AAGTGGGACAGCATCATTGCTAAAACGAAGCCGCCGTACGATTTGACGCTCAAGGAAAACGGCTGCATCATCTTC
ATCGGTGGCCTTGAGGACGGAACCCTGCTCGTTTGCAGTAAGCACTCGACTGGAGAACGCGAGGGCGTCCTGAGT
CATGCCAAAGCCGGCGAGGCTCACTTGGAGAAGCAACTGTCAGCCCTTGGCAAGACGAAGGAGGAGTTCGCCCGA
GAGCTTCGCGAGAGGAATGTAACTGCTGTGGCCGAGCTCTGCGACGACTCATTCGAAGAGCATATCCTCGCGTAC
AGTCCAGAAGACGCTGGCCTATATCTTCACGGCGTCAACAAGAACGAGCCCATCTTCGGCACCTATCCTAGCTCT
GAAGTGCAAAGCTTTGCCGATCAGTGGGGTTTTCGCAAAATTGGAGTCATCACCATGAGCGACGTTCACTCTGTC
CGGACTTTCCTTGAAGAAGCGGCCAAGACAGGGTCTTATCAAGGCAGAGCCGTCGAAGGCTTCGTCATTCGCTGC
AAAATGAGCAAACACCCAGAAACCTTGCCCTACCAAGACTGGTTCTTCAAGTACAAGTTCGATGAGCCATATCTC
ATGTATCGGCAGTGGCGCGAGGTGACGAAACAGATCATCGCGGGCAAGGACCCCGTGTATAAGAAGAACAAGCTC
ATCACGGGACAATACATCAAATACGCTCGCTCCCGACTGGCCGCCGACCCGAAGCTCGGCGAGAAATTTGTGCTC
AACCATGGCATCATCGCCCTCCGCGACGACTTTCTCAAATTCAAGAACCTCGAGGGCTCCGAGGCTGCTGCGATA
CAAGACCCGGAATCGGGCCGGCAACCAAAGGCAGGTGCCCGTCTAGACGAAGTCGATGGAAACGTTGTCTTGTGT
CCGGTGGCGACCATTGGCTGCGGAAAGACGACGTGCGGCGTGGCGTTGACGAAACTGTTCGGCTGGGGCCATCTG
CAGAACGACAACATATCCGGCAAGAATCGCCCACCAAGGTTCTTAGAGTCTGTTGTCTCGGAGCTGAAATCGCGA
CCGGTCGTCTTCGCGGACCGCAACAACGCAGAGAAAAGAGAAAGAGCTCAGCTCATCGACGGTTTGAAGGCTGTC
AAAGCCAACGCCAAGGTGGTCTGCCTCAACTGGGTTCACGATCGTGGTGCGATGAACGACATTCGAAACGTGACC
CTGAGTAGGGTCCAGAACCGTGGTGATAACCACCAGACCATCAAGGCCCACTCGCATTCGCAAAAGTACGAGAAA
ATCATGGATGGCTTTTTGCAGCGCTATCAGGCATGTGAACCCTGGACTTTACCGGACTCCAAGTTCGACTTGATC
ATCGACCTGGATCCTGTGGTGGACTCGCGGGTCAATCTCGACAAGATAATCGCCCACCTTCACAAGTGGTTCCCG
AAATTGGTGCCGGCTATCCCATCGGAGGAGAACGTCGCGGATGCTGTGGGTTATGCGATGACATGCCGGGTGCAA
CCGCAACAAGCAGAACGCCCTCAGAAAGATGGGGCTACGACTGGCAACTTGGAGTATATGGCTGTGCATGTTGAT
GCCAAAGCCATCTACGCATCTCTTCAACAGGCTTTCGACTCGGTCGACGAGAAGACTCGGGCCTTCTTTGCGCAG
CTGAAGCAGAATAAAAGAGTGCAAGATAAGTTTCACGTCACGCTCTTGCATCGGGCATCGGCCAAAGAGCACCCG
GAGCTGTGGAAGAGATATACGGAGGCTTCCGAAGGCATCTCTGGGGAAAATGGCAAAGCCGGCGAATGTGGAGTG
ATACTGGAACGGGTAAGAAGGAAGCAGGCGACTCTCTTCAGCTTCAAAGGCACTAACTTTGTTGCATCCAGGTTG
TATTTGATGACCAGGTCATGGCCATTGTGGTCCGGCTGATAGACAGTGACCAGAAGTGGGAGTGTGCGAACCGCG
TGGCTCACATCACAGTCGGCACTCGAGATGCAAGCATCAAGCCCAAGCAAAGCAACGACCTGTTAGCTAGGTGGC
TGGGCGAGGGCCTCGAGGGTAGCCAGTTGACCGAGGTCGTCTTTGAGCCGAAGCCGACGATTCAAGGCTTTGTCG
GGCCGGTGCGCTCCAGGAGTAATCCGCCTACTAAAAGGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail