Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|184
Gene name
LocationContig_103:15735..17639
Strand+
Gene length (bp)1904
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q58922|Y1527_METJA UPF0132 membrane protein MJ1527 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1527 PE=3 SV=1 381 482 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 390 407 17
2 414 436 22
3 440 462 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|184
MLSGSARLARPRLRQLTSRISSSQSLLSTVAQSSARTVGDSISIPPSTQPPSARPIETRKSQLLRTYTSLLRSTP
VILLFQHINLTSQEWGAVRRELSRALAAVPASDVAGHPELYKAVHLQVLTTTIFKVALKITELYNPQAASSQGEA
LTHDLSKTVYDAIRALQVPPESSYAQLEPLMVGPLAALLLPAVSPAYLSAALSVLAPVPGKFPAPTRRKCPSYHD
PVCQSGLAKLILFGGRVERRILDRAEVDWVAGLTGGLDGLRGQLVSILNGAGLGLTTTLESSGRSIWLALEGRKS
QLEEEKTPDKHARVASPDSLTSPRPSHDATRRSPPLLQHPQPQRAWAGALDGHAADIQGGGGPWADEARLGPDPV
SEFDTSLGIRLDYEACLAYVALPPLGAIVLLVLERNSDYVRFHAWQAALLFTVILVLHIVISPSSFLSWLLFFAD
VGLAAFLALKAYRDAENLDRFEVPFFGAVASRILDDE*
Coding >Ophun1|184
ATGCTCTCGGGCTCAGCTCGCTTGGCCAGGCCCAGGCTGCGGCAGCTTACCTCGAGGATATCCAGCAGTCAGAGC
CTTCTTTCGACTGTTGCGCAGTCGTCCGCCAGGACAGTCGGGGACTCCATCAGCATACCACCGTCTACTCAGCCT
CCGAGCGCGCGGCCGATAGAGACGCGTAAGAGTCAGCTTCTCCGGACCTACACGTCGCTGCTCCGCTCAACTCCC
GTCATCCTCCTCTTCCAGCACATCAACTTGACCTCCCAGGAGTGGGGGGCCGTTCGCCGAGAGCTCAGCAGAGCC
CTTGCCGCCGTCCCGGCTTCCGATGTCGCCGGTCATCCGGAGCTGTACAAGGCGGTGCACCTGCAGGTGCTGACG
ACGACCATCTTCAAAGTTGCCCTCAAGATCACCGAGCTCTATAACCCCCAAGCTGCGTCCTCTCAGGGGGAAGCC
CTCACACACGACCTCTCCAAAACTGTCTACGATGCGATTCGCGCTCTACAAGTCCCGCCCGAGTCTTCTTATGCG
CAGCTCGAACCTCTTATGGTCGGACCTCTGGCCGCGCTCCTTCTTCCGGCTGTGTCGCCGGCATACCTGTCGGCA
GCTTTGAGCGTGCTGGCTCCCGTTCCGGGCAAGTTCCCGGCGCCGACGCGGAGGAAGTGTCCCAGCTATCACGAT
CCCGTTTGCCAAAGCGGATTGGCCAAGCTCATTCTTTTCGGAGGGCGCGTCGAAAGGAGGATACTGGACAGGGCC
GAAGTCGATTGGGTCGCCGGTCTCACGGGCGGTCTGGATGGGCTGCGTGGTCAGCTCGTCAGCATCCTCAACGGG
GCCGGTCTTGGTCTCACGACGACGTTGGAGAGCAGTGGCCGGAGCATCTGGCTGGCGTTGGAGGGCCGGAAGAGT
CAGCTGGAGGAAGAAAAGACCCCTGATAAACACGCGCGCGTCGCGTCTCCCGACTCCCTCACCTCACCTCGCCCA
TCCCACGACGCTACCCGCAGAAGCCCCCCCCTGCTGCAGCACCCGCAGCCTCAGCGCGCCTGGGCCGGAGCTCTA
GACGGTCATGCCGCTGACATTCAAGGCGGTGGAGGCCCGTGGGCCGACGAAGCGCGGTTGGGTCCGGATCCCGTG
AGCGAGTTCGACACCAGCCTCGGCATACGGCTCGATTACGAGGCCTGTCTGGCTTATGTCGCGCTTCCGCCGCTG
GGGGCAATTGTTCTTTTAGTCCTCGAGCGCAATAGCGACTACGTGCGTTTTCACGCCTGGCAGGCCGCCCTGCTC
TTCACCGTCATACTCGTCCTGCACATTGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTTCTTTTCTTCGCCGAT
GTTGGCCTCGCGGCATTTCTTGCTCTCAAGGCATATAGGGATGCCGAGAATCTTGATCGGTTCGAGGTTCCCTTT
TTTGGCGCCGTCGCGAGCCGCATCCTGGATGATGAATAG
Transcript >Ophun1|184
ATGCTCTCGGGCTCAGCTCGCTTGGCCAGGCCCAGGCTGCGGCAGCTTACCTCGAGGATATCCAGCAGTCAGAGC
CTTCTTTCGACTGTTGCGCAGTCGTCCGCCAGGACAGTCGGGGACTCCATCAGCATACCACCGTCTACTCAGCCT
CCGAGCGCGCGGCCGATAGAGACGCGTAAGAGTCAGCTTCTCCGGACCTACACGTCGCTGCTCCGCTCAACTCCC
GTCATCCTCCTCTTCCAGCACATCAACTTGACCTCCCAGGAGTGGGGGGCCGTTCGCCGAGAGCTCAGCAGAGCC
CTTGCCGCCGTCCCGGCTTCCGATGTCGCCGGTCATCCGGAGCTGTACAAGGCGGTGCACCTGCAGGTGCTGACG
ACGACCATCTTCAAAGTTGCCCTCAAGATCACCGAGCTCTATAACCCCCAAGCTGCGTCCTCTCAGGGGGAAGCC
CTCACACACGACCTCTCCAAAACTGTCTACGATGCGATTCGCGCTCTACAAGTCCCGCCCGAGTCTTCTTATGCG
CAGCTCGAACCTCTTATGGTCGGACCTCTGGCCGCGCTCCTTCTTCCGGCTGTGTCGCCGGCATACCTGTCGGCA
GCTTTGAGCGTGCTGGCTCCCGTTCCGGGCAAGTTCCCGGCGCCGACGCGGAGGAAGTGTCCCAGCTATCACGAT
CCCGTTTGCCAAAGCGGATTGGCCAAGCTCATTCTTTTCGGAGGGCGCGTCGAAAGGAGGATACTGGACAGGGCC
GAAGTCGATTGGGTCGCCGGTCTCACGGGCGGTCTGGATGGGCTGCGTGGTCAGCTCGTCAGCATCCTCAACGGG
GCCGGTCTTGGTCTCACGACGACGTTGGAGAGCAGTGGCCGGAGCATCTGGCTGGCGTTGGAGGGCCGGAAGAGT
CAGCTGGAGGAAGAAAAGACCCCTGATAAACACGCGCGCGTCGCGTCTCCCGACTCCCTCACCTCACCTCGCCCA
TCCCACGACGCTACCCGCAGAAGCCCCCCCCTGCTGCAGCACCCGCAGCCTCAGCGCGCCTGGGCCGGAGCTCTA
GACGGTCATGCCGCTGACATTCAAGGCGGTGGAGGCCCGTGGGCCGACGAAGCGCGGTTGGGTCCGGATCCCGTG
AGCGAGTTCGACACCAGCCTCGGCATACGGCTCGATTACGAGGCCTGTCTGGCTTATGTCGCGCTTCCGCCGCTG
GGGGCAATTGTTCTTTTAGTCCTCGAGCGCAATAGCGACTACGTGCGTTTTCACGCCTGGCAGGCCGCCCTGCTC
TTCACCGTCATACTCGTCCTGCACATTGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTTCTTTTCTTCGCCGAT
GTTGGCCTCGCGGCATTTCTTGCTCTCAAGGCATATAGGGATGCCGAGAATCTTGATCGGTTCGAGGTTCCCTTT
TTTGGCGCCGTCGCGAGCCGCATCCTGGATGATGAATAG
Gene >Ophun1|184
ATGCTCTCGGGCTCAGCTCGCTTGGCCAGGCCCAGGCTGCGGCAGCTTACCTCGAGGATATCCAGCAGTCAGAGC
CTTCTTTCGACTGTTGCGCAGTCGTCCGCCAGGACAGTCGGGGACTCCATCAGCATACCACCGTCTACTCAGCCT
CCGAGCGCGCGGCCGATAGAGACGCGTAAGAGTCAGCTTCTCCGGACCTACACGTCGCTGCTCCGCTCAACTCCC
GTCATCCTCCTCTTCCAGCACATCAACTTGACCTCCCAGGAGTGGGGGGCCGTTCGCCGAGAGCTCAGCAGAGCC
CTTGCCGCCGTCCCGGCTTCCGATGTCGCCGGTCATCCGGAGCTGTACAAGGCGGTGCACCTGCAGGTGCTGACG
ACGACCATCTTCAAAGTTGCCCTCAAGATCACCGAGCTCTATAACCCCCAAGCTGCGTCCTCTCAGGGGGAAGCC
CTCACACACGACCTCTCCAAAACTGTCTACGATGCGATTCGCGCTCTACAAGTCCCGCCCGAGTCTTCTTATGCG
CAGCTCGAACCTCTTATGGTCGGACCTCTGGCCGCGCTCCTTCTTCCGGCTGTGTCGCCGGCATACCTGTCGGCA
GCTTTGAGCGTGCTGGCTCCCGTTCCGGGCAAGTTCCCGGCGCCGACGCGGAGGAAGTGTCCCAGCTATCACGAT
CCCGTTTGCCAAAGCGGATTGGCCAAGCTCATTCTTTTCGGAGGGCGCGTCGAAAGGAGGATACTGGACAGGGCC
GAAGTCGATTGGGTCGCCGGTCTCACGGGCGGTCTGGATGGGCTGCGTGGTCAGCTCGTCAGCATCCTCAACGGG
GCCGGTCTTGGTCTCACGACGACGTTGGAGAGCAGTGGCCGGAGCATCTGGCTGGCGTTGGAGGGCCGGAAGAGT
CAGCTGGAGGAAGAAAAGACCCCTGATAGTGAGTAGGTAGCTGTCTACTATTTACAGCTACGCCGAGGTGTCCAA
GTGATAGATATATCGACGAAGTACGAATACCCTATCCGGTTACCTGTCTATCCACGAGGAAGTGGTAGGTAGGTA
GCTTGGTGAATCGGCCTGTGATGCGTCATGCGCTCATTCAGGGTGCAGGTAAAAGCCCGAACCTTTTCCGAGCGA
GGCGCGAGGCGCAAAGCTCCGTATGAACTTCGAGCGATAAGACCTAAATTAGGTATCAACATCAACTACCTGCCT
CTACGAAGACCTACTCACCAACCTATCAATAACGAACAGCTCGAAAAGAAAAACAACTCGGAGGGCTTGCCCTCG
CCATGGACTTTGCTCCCTACCAATCATCGCCCCCAGAACACGCGCGCGTCGCGTCTCCCGACTCCCTCACCTCAC
CTCGCCCATCCCACGACGCTACCCGCAGAAGCCCCCCCCTGCTGCAGCACCCGCAGCCTCAGCGCGCCTGGGCCG
GAGCTCTAGACGGTCATGCCGCTGACATTCAAGGCGGTGGAGGCCCGTGGGCCGACGAAGCGCGGTTGGGTCCGG
ATCCCGTGAGCGAGTTCGACACCAGCCTCGGCATACGGCTCGATTACGAGGCCTGTCTGGCTTATGTCGCGCTTC
CGCCGCTGGGGGCAATTGTTCTTTTAGTCCTCGAGCGCAATAGCGACTACGTGCGTTTTCACGCCTGGCAGGCCG
CCCTGCTCTTCACCGTCATACTCGTCCTGCACATTGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTTCTTTTCT
TCGCCGATGTTGGCCTCGCGGCATTTCTTGCTCTCAAGGCATATAGGGATGCCGAGAATCTTGATCGGTGAGCAC
GCTCTGATCTCCTCTTACACATGATGATCCTAAGCTTACGTGACTACAGGTTCGAGGTTCCCTTTTTTGGCGCCG
TCGCGAGCCGCATCCTGGATGATGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail