Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1832
Gene name
LocationContig_180:20784..21535
Strand-
Gene length (bp)751
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08432 Vfa1 AAA-ATPase Vps4-associated protein 1 1.7E-55 7 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V9|YNH1_SCHPO UPF0589 protein C32H8.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC32H8.01c PE=3 SV=1 1 69 1.0E-14
sp|P40080|VFA1_YEAST VPS4-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VFA1 PE=1 SV=1 7 184 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1832
MSAPFPNLYSHRKVAESSAKACDICYKPTTSVLITPGNKDFFYVCPAHLKDKYFCTPKVDEDAIKAKREKAVAEE
MERLKKEYEEQQRKKKEKESKDKEKNKDKEKGKGQEEQDKEKGEAKEDKNQDKDKKQETEATDTLGEEPRIFELK
SAFYQQRLQKKRQAEMAKRDRERASQPNYFPSVPTDLPGK*
Coding >Ophun1|1832
ATGTCAGCGCCTTTCCCGAACCTGTACTCGCATCGTAAGGTTGCTGAGTCGTCAGCCAAGGCGTGCGACATCTGC
TACAAGCCCACCACTTCCGTGCTCATCACGCCAGGGAACAAGGACTTCTTCTATGTCTGCCCAGCCCACCTGAAG
GACAAGTACTTTTGCACGCCCAAGGTCGACGAGGATGCCATCAAGGCCAAGAGGGAAAAGGCGGTGGCGGAGGAG
ATGGAGCGGCTGAAGAAGGAATACGAGGAGCAGCAGCGGAAGAAGAAGGAAAAGGAGTCTAAGGATAAGGAAAAG
AACAAGGACAAGGAAAAGGGAAAGGGACAAGAAGAACAGGATAAGGAAAAGGGAGAGGCAAAAGAAGACAAGAAT
CAAGACAAGGACAAGAAGCAGGAAACAGAGGCTACAGACACGCTGGGGGAGGAGCCCCGGATCTTCGAGCTCAAG
AGTGCCTTCTACCAGCAGCGGCTACAGAAGAAGCGACAGGCCGAGATGGCGAAGCGAGATCGCGAGCGGGCGTCT
CAGCCCAACTACTTTCCTTCCGTTCCCACCGATCTGCCCGGGAAGTGA
Transcript >Ophun1|1832
ATGTCAGCGCCTTTCCCGAACCTGTACTCGCATCGTAAGGTTGCTGAGTCGTCAGCCAAGGCGTGCGACATCTGC
TACAAGCCCACCACTTCCGTGCTCATCACGCCAGGGAACAAGGACTTCTTCTATGTCTGCCCAGCCCACCTGAAG
GACAAGTACTTTTGCACGCCCAAGGTCGACGAGGATGCCATCAAGGCCAAGAGGGAAAAGGCGGTGGCGGAGGAG
ATGGAGCGGCTGAAGAAGGAATACGAGGAGCAGCAGCGGAAGAAGAAGGAAAAGGAGTCTAAGGATAAGGAAAAG
AACAAGGACAAGGAAAAGGGAAAGGGACAAGAAGAACAGGATAAGGAAAAGGGAGAGGCAAAAGAAGACAAGAAT
CAAGACAAGGACAAGAAGCAGGAAACAGAGGCTACAGACACGCTGGGGGAGGAGCCCCGGATCTTCGAGCTCAAG
AGTGCCTTCTACCAGCAGCGGCTACAGAAGAAGCGACAGGCCGAGATGGCGAAGCGAGATCGCGAGCGGGCGTCT
CAGCCCAACTACTTTCCTTCCGTTCCCACCGATCTGCCCGGGAAGTGA
Gene >Ophun1|1832
ATGTCAGCGCCTTTCCCGAACCTGTACTCGCATCGTAAGGTTGCTGAGTCGTCAGCCAAGGCGTGCGACATCTGC
TACAAGCCCACCACTTCCGTGCTCATCACGCCAGGGAACAAGGTGAGCGAAGCTGGGAAGGGAACCTGGGCTTCA
GCCTTGAGGCACTGACTGACACGCTATATAGGACTTCTTCTATGTCTGCCCAGCCCACCTGAAGGACAAGTACTT
TTGCACGCCCAAGGTCGACGAGGATGCCATCAAGGCCAAGAGGGAAAAGGCGGTGGCGGAGGAGATGGAGCGGCT
GAAGAAGGAATACGAGGAGCAGCAGCGGAAGAAGAAGGAAAAGGAGTCTAAGGATAAGGAAAAGAACAAGGACAA
GGAAAAGGGAAAGGGACAAGAAGAACAGGATAAGGAAAAGGGAGAGGCAAAAGAAGACAAGAATCAAGACAAGGA
CAAGAAGCAGGAAACAGAGGTAGCACAGATCCCTCGACGTCCCCTCGGAAACCAACACTGAGGCACAACGCAGGC
TACAGACACGCTGGGGGAGGAGCCCCGGATCTTCGAGCTCAAGAGGTAACCACAAAACACCAAGGCTCCTCTCGC
CATCCTCGGCTGACGAGTGATGGCAAGCAGTGCCTTCTACCAGCAGCGGCTACAGAAGAAGCGACAGGCCGAGAT
GGCGAAGCGAGATCGCGAGCGGGCGTCTCAGCCCAACTACTTTCCTTCCGTTCCCACCGATCTGCCCGGGAAGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail