Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|183
Gene name
LocationContig_103:13264..14640
Strand-
Gene length (bp)1376
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03856 SUN Beta-glucosidase (SUN family) 3.5E-85 174 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WGL5|SUN1_ASPFU Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sun1 PE=1 SV=1 166 437 3.0E-71
sp|P53616|SUN4_YEAST Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUN4 PE=1 SV=1 165 439 9.0E-66
sp|P40472|SIM1_YEAST Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIM1 PE=1 SV=2 165 439 5.0E-65
sp|D4AM57|SUN41_ARTBC Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04747 PE=1 SV=1 166 410 8.0E-65
sp|P46955|NCA3_YEAST Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCA3 PE=1 SV=1 171 437 1.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WGL5|SUN1_ASPFU Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sun1 PE=1 SV=1 166 437 3.0E-71
sp|P53616|SUN4_YEAST Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUN4 PE=1 SV=1 165 439 9.0E-66
sp|P40472|SIM1_YEAST Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIM1 PE=1 SV=2 165 439 5.0E-65
sp|D4AM57|SUN41_ARTBC Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04747 PE=1 SV=1 166 410 8.0E-65
sp|P46955|NCA3_YEAST Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCA3 PE=1 SV=1 171 437 1.0E-61
sp|Q59NP5|SUN41_CANAL Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUN41 PE=1 SV=1 169 432 6.0E-60
sp|O43015|YBOH_SCHPO Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2G2.17c PE=3 SV=1 171 413 2.0E-58
sp|A7A003|UTH1_YEAS7 Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=UTH1 PE=3 SV=2 170 432 4.0E-58
sp|P36135|UTH1_YEAST Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTH1 PE=1 SV=2 170 432 4.0E-58
sp|B5VMJ0|UTH1_YEAS6 Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UTH1 PE=3 SV=2 170 432 5.0E-58
sp|B3LRC2|UTH1_YEAS1 Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UTH1 PE=3 SV=1 170 432 5.0E-58
sp|Q5AKU5|UTH1_CANAL Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIM1 PE=1 SV=1 169 432 4.0E-47
sp|Q9UR09|PSU1_SCHPO Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psu1 PE=3 SV=1 171 437 3.0E-46
sp|O74851|ADG3_SCHPO Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adg3 PE=2 SV=1 223 389 7.0E-20
sp|Q04018|YM79_YEAST Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR244W PE=3 SV=1 221 386 8.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|183
MKCLAMKSLASYALVASLVAVARARSHHHFHHHHRKNVASLVQRAESHPTVENSPVQTVYQDMGGKSMTSDEAEQ
CLESGRCVVVRETVPQKQPEPASAPPPPPPPPPPPAAHSLKAPVDGAKFIETKATYKPPPAANHPPATAGPAAYT
KLEPESDHESGPSSSGLNKEFPSGTIKCSQFPSAYGAVPLQWHDMGGWCGIQDVPGFSLSIASITHIATGKECSP
DSMCSYACPPGYQKTQWPAAQGSNHESVGGLFCNKDGFLELTRPESKTLCKKGVGGVVVRNKLNEQVTLCRTDYP
GTENMAIPTVAKPGVEVELTNPDQNTYYQWAGKPTSAQYYANLAGLGPEDACVWKNSKSTLSGKTGNWAPLNIGT
GFDGKNTYISLFPNLPTSDCALDYDVSIEGDVIGGCSYTRFTTGSEMKRCTATLKPGGKAVIVIS*
Coding >Ophun1|183
ATGAAGTGTCTGGCTATGAAGAGCCTGGCGAGTTACGCTCTCGTGGCCTCTCTGGTCGCAGTTGCCCGTGCTCGC
TCACACCATCATTTCCACCACCATCACCGAAAGAATGTCGCGTCTTTGGTGCAGCGGGCCGAGTCGCATCCCACA
GTCGAGAACAGCCCCGTTCAGACCGTCTATCAGGACATGGGAGGAAAGTCGATGACGTCGGACGAAGCTGAACAG
TGTTTAGAGAGCGGAAGATGTGTCGTCGTCCGAGAAACAGTTCCCCAAAAGCAGCCGGAGCCTGCATCGGCGCCA
CCGCCACCTCCACCTCCACCGCCACCGCCGGCTGCTCACAGTCTCAAGGCGCCCGTTGACGGCGCCAAGTTCATC
GAGACAAAGGCCACTTACAAGCCGCCGCCTGCTGCCAATCACCCGCCCGCCACCGCCGGTCCTGCGGCGTACACC
AAGCTTGAACCCGAGTCCGACCACGAGTCTGGCCCTAGCTCTTCCGGCCTGAACAAGGAGTTTCCCAGCGGGACC
ATCAAATGCTCACAGTTCCCATCTGCTTACGGTGCCGTACCCCTTCAGTGGCACGACATGGGCGGCTGGTGTGGC
ATTCAAGATGTTCCTGGCTTCAGCCTCAGCATCGCCAGTATCACTCATATCGCCACGGGCAAGGAATGCTCACCC
GATTCCATGTGCTCTTACGCCTGTCCACCAGGCTATCAAAAGACACAGTGGCCGGCTGCTCAGGGATCCAATCAT
GAATCCGTCGGCGGCCTCTTCTGTAACAAGGACGGCTTCCTCGAGCTCACTCGCCCCGAATCGAAGACGCTCTGC
AAGAAAGGCGTTGGTGGCGTCGTCGTGAGGAACAAACTGAACGAACAGGTCACCCTCTGCCGCACCGACTATCCT
GGAACCGAGAACATGGCCATCCCAACCGTCGCCAAGCCAGGCGTCGAAGTCGAGCTCACCAATCCCGACCAAAAC
ACCTATTACCAGTGGGCGGGAAAGCCCACCTCGGCTCAGTATTATGCCAATCTCGCCGGCCTGGGCCCCGAAGAT
GCCTGTGTGTGGAAAAATAGTAAATCGACATTAAGCGGCAAGACAGGCAACTGGGCGCCCCTGAACATCGGCACC
GGCTTCGACGGGAAAAACACTTATATCAGCCTGTTTCCCAACTTGCCTACCAGTGACTGCGCCCTCGATTATGAT
GTCTCCATCGAAGGTGACGTGATCGGCGGATGCTCTTACACCAGGTTCACCACGGGAAGCGAGATGAAACGCTGC
ACGGCCACTCTCAAACCCGGTGGCAAAGCAGTCATAGTCATCTCTTGA
Transcript >Ophun1|183
ATGAAGTGTCTGGCTATGAAGAGCCTGGCGAGTTACGCTCTCGTGGCCTCTCTGGTCGCAGTTGCCCGTGCTCGC
TCACACCATCATTTCCACCACCATCACCGAAAGAATGTCGCGTCTTTGGTGCAGCGGGCCGAGTCGCATCCCACA
GTCGAGAACAGCCCCGTTCAGACCGTCTATCAGGACATGGGAGGAAAGTCGATGACGTCGGACGAAGCTGAACAG
TGTTTAGAGAGCGGAAGATGTGTCGTCGTCCGAGAAACAGTTCCCCAAAAGCAGCCGGAGCCTGCATCGGCGCCA
CCGCCACCTCCACCTCCACCGCCACCGCCGGCTGCTCACAGTCTCAAGGCGCCCGTTGACGGCGCCAAGTTCATC
GAGACAAAGGCCACTTACAAGCCGCCGCCTGCTGCCAATCACCCGCCCGCCACCGCCGGTCCTGCGGCGTACACC
AAGCTTGAACCCGAGTCCGACCACGAGTCTGGCCCTAGCTCTTCCGGCCTGAACAAGGAGTTTCCCAGCGGGACC
ATCAAATGCTCACAGTTCCCATCTGCTTACGGTGCCGTACCCCTTCAGTGGCACGACATGGGCGGCTGGTGTGGC
ATTCAAGATGTTCCTGGCTTCAGCCTCAGCATCGCCAGTATCACTCATATCGCCACGGGCAAGGAATGCTCACCC
GATTCCATGTGCTCTTACGCCTGTCCACCAGGCTATCAAAAGACACAGTGGCCGGCTGCTCAGGGATCCAATCAT
GAATCCGTCGGCGGCCTCTTCTGTAACAAGGACGGCTTCCTCGAGCTCACTCGCCCCGAATCGAAGACGCTCTGC
AAGAAAGGCGTTGGTGGCGTCGTCGTGAGGAACAAACTGAACGAACAGGTCACCCTCTGCCGCACCGACTATCCT
GGAACCGAGAACATGGCCATCCCAACCGTCGCCAAGCCAGGCGTCGAAGTCGAGCTCACCAATCCCGACCAAAAC
ACCTATTACCAGTGGGCGGGAAAGCCCACCTCGGCTCAGTATTATGCCAATCTCGCCGGCCTGGGCCCCGAAGAT
GCCTGTGTGTGGAAAAATAGTAAATCGACATTAAGCGGCAAGACAGGCAACTGGGCGCCCCTGAACATCGGCACC
GGCTTCGACGGGAAAAACACTTATATCAGCCTGTTTCCCAACTTGCCTACCAGTGACTGCGCCCTCGATTATGAT
GTCTCCATCGAAGGTGACGTGATCGGCGGATGCTCTTACACCAGGTTCACCACGGGAAGCGAGATGAAACGCTGC
ACGGCCACTCTCAAACCCGGTGGCAAAGCAGTCATAGTCATCTCTTGA
Gene >Ophun1|183
ATGAAGTGTCTGGCTATGAAGAGCCTGGCGAGTTACGCTCTCGTGGCCTCTCTGGTCGCAGTTGCCCGTGCTCGC
TCACACCATCATTTCCACCACCATCACCGAAAGAATGTCGCGTCTTTGGTGCAGCGGGCCGAGTCGCATCCCACA
GTCGAGAACAGCCCCGTTCAGACCGTCTATCAGGACATGGGAGGAAAGTCGATGACGTCGGACGAAGCTGAACAG
TGTTTAGAGAGCGGAAGATGTGTCGTCGTCCGAGAAACAGTTCCCCAAAAGCAGCCGGAGCCTGCATCGGCGCCA
CCGCCACCTCCACCTCCACCGCCACCGCCGGCTGCTCACAGTCTCAAGGCGCCCGTTGACGGCGCCAAGTTCATC
GAGACAAAGGCCACTTACAAGCCGCCGCCTGCTGCCAATCACCCGCCCGCCACCGCCGGTCCTGCGGCGTACACC
AAGCTTGAACCCGAGTCCGACCACGAGTCTGGCCCTAGCTCTTCCGGCCTGAACAAGGAGTTTCCCAGCGGGACC
ATCAAATGCTCACAGTTCCCATCTGCTTACGGTGCCGTACCCCTTCAGTGGCACGACATGGGCGGCTGGTGTGGC
ATTCAAGATGTTCCTGGCTTCAGCCTCAGCATCGCCAGTATCACTCATATCGCCACGGGCAAGGAATGCTCACCC
GATTCCATGTGCTCTTACGCCTGTCCACCAGGCTATCAAAAGACACAGTGGCCGGCTGCTCAGGGATCCAATCAT
GAATCCGTCGGCGGCCTCTTCTGTAACAAGGACGGCTTCCTCGAGCTCACTCGCCCCGAATCGAAGACGCTCTGC
AAGAAAGGCGTTGGTGGCGTCGTCGTGAGGAACAAACTGAACGAACAGGTCACCCTCTGCCGCACCGACTATCCT
GGAACCGAGAACATGGCCATCCCAACCGTCGCCAAGCCAGGCGTCGAAGTCGAGCTCACCAATCCCGACCAAAAC
ACCTATTACCAGTGGGCGGGAAAGCCCACCTCGGCTCAGTATTATGCCAATCTCGCCGGCCTGGGCCCCGAAGAT
GCCTGTGTGTGGAAAAATAGTAAATCGACATTAAGCGGCAAGACAGGCAACTGGGCGCCCCTGAACATCGGCACC
GGCTTCGACGGGAAAAACACTTATATCAGCCTGTTTCCCAACTTGCCTACCAGTGACTGCGCCCTCGATTATGAT
GTCTCCATCGAAGGTGACGTGATCGGCGGATGCTCTTACACCAGGTTCACCACGGGAAGCGAGATGAAACGCTGC
ACGGTGAGTGCCACGGGATCCCCCATTTGGTCTGTACTCCAGCTGACTCCTTGTAGGCCACTCTCAAACCCGGTG
GCAAAGCAGTCATAGTCATCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail