Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1828
Gene name
LocationContig_180:11057..13572
Strand-
Gene length (bp)2515
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00348 polyprenyl_synt Polyprenyl synthetase 8.6E-29 401 535
PF00348 polyprenyl_synt Polyprenyl synthetase 2.4E-13 538 605
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 2.1E-11 177 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 8 665 1.0E-82
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 26 655 5.0E-68
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 24 665 7.0E-65
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 398 661 2.0E-57
sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=1 SV=1 398 640 1.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 8 665 1.0E-82
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 26 655 5.0E-68
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 24 665 7.0E-65
sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 398 661 2.0E-57
sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=1 SV=1 398 640 1.0E-56
sp|Q6F596|GGPPS_RAT Geranylgeranyl pyrophosphate synthase OS=Rattus norvegicus GN=Ggps1 PE=2 SV=1 398 640 9.0E-56
sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 398 661 1.0E-55
sp|P56966|GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus GN=GGPS1 PE=1 SV=2 398 640 2.0E-55
sp|O95749|GGPPS_HUMAN Geranylgeranyl pyrophosphate synthase OS=Homo sapiens GN=GGPS1 PE=1 SV=1 398 640 2.0E-55
sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 398 633 8.0E-54
sp|Q54BK1|GGPPS_DICDI Geranylgeranyl pyrophosphate synthase OS=Dictyostelium discoideum GN=ggps1 PE=3 SV=1 378 667 2.0E-51
sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 392 666 1.0E-50
sp|B2DBE8|GGS1_PHOAM Geranylgeranyl pyrophosphate synthase A OS=Phomopsis amygdali GN=GGS-A PE=1 SV=1 399 665 4.0E-49
sp|Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTS1 PE=1 SV=1 395 641 6.0E-38
sp|Q758K0|GGPPS_ASHGO Geranylgeranyl pyrophosphate synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTS1 PE=3 SV=1 402 634 5.0E-35
sp|Q58270|IDSA_METJA Short chain isoprenyl diphosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=idsA PE=3 SV=1 422 668 3.0E-15
sp|P0AD58|ISPB_SHIFL Octaprenyl-diphosphate synthase OS=Shigella flexneri GN=ispB PE=3 SV=1 443 640 3.0E-14
sp|P0AD57|ISPB_ECOLI Octaprenyl-diphosphate synthase OS=Escherichia coli (strain K12) GN=ispB PE=1 SV=1 443 640 3.0E-14
sp|Q76FS5|SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=SPS2 PE=1 SV=1 436 597 2.0E-08
sp|Q0INZ4|SPS3_ORYSJ Probable solanesyl-diphosphate synthase 3, chloroplastic (Fragment) OS=Oryza sativa subsp. japonica GN=SPS3 PE=3 SV=1 434 616 5.0E-08
sp|Q75HZ9|SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=SPS2 PE=1 SV=2 434 616 3.0E-07
sp|Q8S948|SPS1_ARATH Solanesyl diphosphate synthase 1 OS=Arabidopsis thaliana GN=SPS1 PE=1 SV=1 436 597 3.0E-07
sp|O66129|HEXB_MICLU Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) OS=Micrococcus luteus GN=hexs-b PE=1 SV=1 443 588 1.0E-06
sp|P39464|GGPS_SULAC Geranylgeranyl diphosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gds PE=1 SV=1 443 586 1.0E-06
sp|Q9UR08|ARIS_ASPTE Aristolochene synthase OS=Aspergillus terreus GN=Ari1 PE=1 SV=1 40 327 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008299 isoprenoid biosynthetic process Yes
GO:0006720 isoprenoid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1828
MDSCHHHSDLLDAETVAKTCPTKLAVRRSRYHQIHDAAIEEFSQQWEAAGGNRFLGLQSPQGSLIALGLPECVPD
RIRVVTRMSELLFGVDGELAVFPLRSLVQSVAFRSLEPHGLQYSPSGTASINPQDDLNIAQKQLYSEIMADFVAI
DPVRGRPVLQAIDQHRQGFGGTLTDDLESWDNWLQFRYQDGGCDLYLRVLAFACELDISDADFRSVHDIARAGMA
ATTLSNDIYSFDVESVLEIQTGGNINNGVWYLMKALDLTVKEAKHILLTEKITPLEAEFIRGKAEFVQNNRLSAP
NLVRFLHQVELMVSGNWYWGRFANRYNRWREAMSHFGGVHVSGIRIFTVDEATAKCSAFYDAAGQTVVQSKENGA
LSLQNGRVETHEETPGAKLDRTIVLGPIQYLQMLPSKNIRGLLIDALRSWLTVPEEALQCLQKVASHLHNASLLL
DDIEDDSPLRRGKPSAHRVFGRSQTINSANFLYLMAVEEVFFLSDESRRIFTDELRNLHVGQSYDLYWTQTNHCP
SFSEYYDMVRLNLCDFLTVLGQFFQIRDDYINLTSDKYEKQKGIAEDLDEGKRSFPLIHLLTNSPDRAMMESILQ
QRWQEGSMSADLKELVLEKMEEAGSLAYTKRILDSFSDRARTLLAGLEEQAGSNNYILRYLIERLADY*
Coding >Ophun1|1828
ATGGACTCCTGCCATCATCACTCTGACCTCCTCGACGCTGAAACCGTCGCCAAGACGTGTCCAACCAAGCTGGCC
GTCCGCAGAAGCAGATACCACCAGATTCACGACGCCGCCATTGAAGAATTCTCACAGCAATGGGAGGCCGCGGGA
GGGAACCGGTTCTTGGGACTGCAATCCCCTCAGGGATCTCTGATTGCCTTGGGCCTGCCGGAATGTGTCCCCGAC
AGGATCCGTGTAGTCACCCGGATGTCGGAGCTTCTCTTTGGTGTAGACGGTGAATTGGCCGTGTTCCCGCTGAGA
AGTCTCGTGCAGTCTGTCGCCTTCCGATCTCTCGAGCCACACGGACTTCAATACAGCCCCTCGGGAACCGCATCT
ATCAATCCCCAAGACGACCTCAACATAGCCCAGAAACAGCTCTACTCCGAAATCATGGCCGACTTCGTGGCAATC
GACCCAGTCAGAGGAAGGCCAGTGCTGCAGGCCATCGACCAGCATCGACAGGGATTTGGAGGAACGCTGACGGAT
GACCTCGAGTCCTGGGACAACTGGCTTCAGTTTCGCTACCAAGACGGAGGCTGCGACCTTTACCTCCGGGTCCTC
GCCTTTGCGTGTGAACTTGACATCTCTGACGCCGACTTTCGCTCTGTACACGACATTGCTCGAGCGGGAATGGCG
GCAACAACCCTTTCCAACGACATCTACAGCTTCGACGTCGAATCTGTCCTCGAGATCCAGACGGGCGGCAACATC
AACAACGGCGTTTGGTATCTGATGAAGGCGCTCGACCTCACCGTCAAAGAGGCAAAGCACATCCTCCTCACCGAG
AAGATCACCCCTCTCGAGGCCGAGTTCATACGTGGGAAAGCCGAGTTCGTGCAGAACAACAGACTGTCAGCGCCG
AATCTAGTGCGATTCCTTCATCAGGTTGAGCTCATGGTCTCGGGAAACTGGTACTGGGGTCGCTTTGCGAATCGC
TATAACCGGTGGAGAGAGGCCATGTCGCACTTTGGCGGCGTTCACGTCTCGGGTATTCGCATCTTTACTGTTGAT
GAGGCAACTGCAAAGTGCTCGGCCTTTTATGATGCTGCGGGACAGACTGTTGTCCAGAGTAAAGAGAATGGCGCT
CTTTCACTGCAGAATGGGCGAGTTGAGACGCATGAAGAGACGCCTGGCGCGAAGCTTGACAGAACGATTGTCCTC
GGTCCTATCCAGTACCTCCAGATGCTCCCATCCAAGAACATCAGAGGCCTCTTGATCGACGCCCTCCGCTCATGG
CTGACAGTCCCGGAGGAAGCGCTCCAATGCCTTCAAAAAGTGGCTTCGCACCTGCACAACGCGTCGCTGCTGCTG
GATGACATAGAGGATGATTCGCCGTTGCGACGGGGGAAGCCCTCGGCTCATCGGGTGTTTGGACGCTCTCAGACG
ATTAATTCTGCGAATTTTCTGTATCTCATGGCTGTGGAAGAGGTGTTTTTTCTGAGCGACGAGTCTCGTCGTATC
TTTACCGACGAGTTGAGAAACCTTCACGTTGGGCAGAGCTATGATCTCTACTGGACGCAGACGAATCACTGCCCT
TCTTTCAGCGAATACTACGACATGGTTCGCCTAAATCTGTGCGACTTCCTGACTGTCCTCGGGCAATTCTTCCAA
ATCCGCGACGATTACATCAACCTAACCTCAGACAAGTATGAGAAGCAAAAAGGCATCGCAGAAGACTTGGACGAG
GGAAAACGCTCCTTTCCTCTCATCCACCTCTTAACCAACTCCCCCGACCGCGCTATGATGGAGAGCATTCTACAG
CAGCGATGGCAAGAGGGAAGCATGTCCGCCGACTTGAAGGAGCTGGTGCTGGAGAAGATGGAAGAGGCCGGCAGC
CTGGCCTACACTAAGAGAATCCTGGATTCTTTCTCAGATAGGGCCAGGACATTGCTTGCTGGTCTTGAAGAGCAG
GCGGGAAGCAACAACTACATTCTTCGCTATCTGATTGAGCGCTTGGCAGATTACTAG
Transcript >Ophun1|1828
ATGGACTCCTGCCATCATCACTCTGACCTCCTCGACGCTGAAACCGTCGCCAAGACGTGTCCAACCAAGCTGGCC
GTCCGCAGAAGCAGATACCACCAGATTCACGACGCCGCCATTGAAGAATTCTCACAGCAATGGGAGGCCGCGGGA
GGGAACCGGTTCTTGGGACTGCAATCCCCTCAGGGATCTCTGATTGCCTTGGGCCTGCCGGAATGTGTCCCCGAC
AGGATCCGTGTAGTCACCCGGATGTCGGAGCTTCTCTTTGGTGTAGACGGTGAATTGGCCGTGTTCCCGCTGAGA
AGTCTCGTGCAGTCTGTCGCCTTCCGATCTCTCGAGCCACACGGACTTCAATACAGCCCCTCGGGAACCGCATCT
ATCAATCCCCAAGACGACCTCAACATAGCCCAGAAACAGCTCTACTCCGAAATCATGGCCGACTTCGTGGCAATC
GACCCAGTCAGAGGAAGGCCAGTGCTGCAGGCCATCGACCAGCATCGACAGGGATTTGGAGGAACGCTGACGGAT
GACCTCGAGTCCTGGGACAACTGGCTTCAGTTTCGCTACCAAGACGGAGGCTGCGACCTTTACCTCCGGGTCCTC
GCCTTTGCGTGTGAACTTGACATCTCTGACGCCGACTTTCGCTCTGTACACGACATTGCTCGAGCGGGAATGGCG
GCAACAACCCTTTCCAACGACATCTACAGCTTCGACGTCGAATCTGTCCTCGAGATCCAGACGGGCGGCAACATC
AACAACGGCGTTTGGTATCTGATGAAGGCGCTCGACCTCACCGTCAAAGAGGCAAAGCACATCCTCCTCACCGAG
AAGATCACCCCTCTCGAGGCCGAGTTCATACGTGGGAAAGCCGAGTTCGTGCAGAACAACAGACTGTCAGCGCCG
AATCTAGTGCGATTCCTTCATCAGGTTGAGCTCATGGTCTCGGGAAACTGGTACTGGGGTCGCTTTGCGAATCGC
TATAACCGGTGGAGAGAGGCCATGTCGCACTTTGGCGGCGTTCACGTCTCGGGTATTCGCATCTTTACTGTTGAT
GAGGCAACTGCAAAGTGCTCGGCCTTTTATGATGCTGCGGGACAGACTGTTGTCCAGAGTAAAGAGAATGGCGCT
CTTTCACTGCAGAATGGGCGAGTTGAGACGCATGAAGAGACGCCTGGCGCGAAGCTTGACAGAACGATTGTCCTC
GGTCCTATCCAGTACCTCCAGATGCTCCCATCCAAGAACATCAGAGGCCTCTTGATCGACGCCCTCCGCTCATGG
CTGACAGTCCCGGAGGAAGCGCTCCAATGCCTTCAAAAAGTGGCTTCGCACCTGCACAACGCGTCGCTGCTGCTG
GATGACATAGAGGATGATTCGCCGTTGCGACGGGGGAAGCCCTCGGCTCATCGGGTGTTTGGACGCTCTCAGACG
ATTAATTCTGCGAATTTTCTGTATCTCATGGCTGTGGAAGAGGTGTTTTTTCTGAGCGACGAGTCTCGTCGTATC
TTTACCGACGAGTTGAGAAACCTTCACGTTGGGCAGAGCTATGATCTCTACTGGACGCAGACGAATCACTGCCCT
TCTTTCAGCGAATACTACGACATGGTTCGCCTAAATCTGTGCGACTTCCTGACTGTCCTCGGGCAATTCTTCCAA
ATCCGCGACGATTACATCAACCTAACCTCAGACAAGTATGAGAAGCAAAAAGGCATCGCAGAAGACTTGGACGAG
GGAAAACGCTCCTTTCCTCTCATCCACCTCTTAACCAACTCCCCCGACCGCGCTATGATGGAGAGCATTCTACAG
CAGCGATGGCAAGAGGGAAGCATGTCCGCCGACTTGAAGGAGCTGGTGCTGGAGAAGATGGAAGAGGCCGGCAGC
CTGGCCTACACTAAGAGAATCCTGGATTCTTTCTCAGATAGGGCCAGGACATTGCTTGCTGGTCTTGAAGAGCAG
GCGGGAAGCAACAACTACATTCTTCGCTATCTGATTGAGCGCTTGGCAGATTACTAG
Gene >Ophun1|1828
ATGGACTCCTGCCATCATCACTCTGACCTCCTCGACGCTGAAACCGTCGCCAAGACGTGTCCAACCAAGCTGGCC
GTCCGCAGAAGCAGATACCACCAGATTCACGACGCCGCCATTGAAGAATTCTCACAGCAATGGGAGGCCGCGGGA
GGGAACCGGTTCTTGGGACTGCAATCCCCTCAGGGATCTCTGATTGCCTTGGGCCTGCCGGAATGTGTCCCCGAC
AGGATCCGTGTAGTCACCCGGATGTCGGAGCTTCTCTTTGGTGTAGACGGTGAATTGGCCGTGTTCCCGCTGAGA
AGTCTGTGACTGAGATTGATCAGACTTGGTTGCGGCTAAGAAGAGGGAAGAGGTAGGCTACACGGTCCTCCAAGA
GCTCAACTTCTTATATGAAGCGTGCAGTCTGTCGCCTTCCGATCTCTCGAGCCACACGGACTTCAATACAGCCCC
TCGGGAACCGCATCTATCAATCCCCAAGACGACCTCAACATAGCCCAGAAACAGCTCTACTCCGAAATCATGGCC
GACTTCGTGGCAATCGACCCAGTCAGAGGAAGGCCAGTGCTGCAGGCCATCGACCAGCATCGACAGGGATTTGGA
GGAACGCTGACGGATGACCTCGAGTCCTGGGACAACTGGCTTCAGTTTCGCTACCAAGACGGAGGCTGCGAGTGC
GTACAGCTTTCAGTATCTAGTTGCTGGCTGATTGACTCCCCTTGAATCTGACCCTGAACAGCCTTTACCTCCGGG
TCCTCGCCTTTGCGTGTGAACTTGACATCTCTGACGCCGACTTTCGCTCTGTACACGACATTGCTCGAGCGGGAA
TGGCGGCAACAACCCTTTCCAACGACATCTACAGCTTCGACGTCGAATCTGTCCTCGAGATCCAGACGGGCGGCA
ACATCAACAACGGCGTTTGGTATCTGATGAAGGCGCTCGACCTCACCGTCAAAGAGGCAAAGCACATCCTCCTCA
CCGAGAAGATCACCCCTCTCGAGGCCGAGTTCATACGTGGGAAAGCCGAGTTCGTGCAGAACAACAGACTGTCAG
CGCCGAATCTAGTGCGATTCCTTCATCAGGTTGAGCTCATGGTCTCGGGAAACTGGTACTGGGGTCGCTTTGCGA
ATCGCTATAACCGGTGGAGAGAGGCCATGTCGCACTTTGGCGGCGTTCACGTCTCGGGTATTCGCATCTTTACTG
TTGATGAGGCAACTGCAAAGTGCTCGGCCTTTTATGATGCTGCGGGACAGACTGTTGTCCAGAGTAAAGAGAATG
GCGCTCTTTCACTGCAGAATGGGCGAGTTGAGACGCATGAAGAGACGCCTGGCGCGAAGCTTGACAGAACGGTGA
GTCTGCTCGCTCTGATTCGAGACACAAAAAGACATCCATGTTCTCATCGTGTTCTCAGATTGTCCTCGGTCCTAT
CCAGTACCTCCAGATGCTCCCATCCAAGAACATCAGAGGCCTCTTGATCGACGCCCTCCGCTCATGGCTGACAGT
CCCGGAGGAAGCGCTCCAATGCCTTCAAAAAGTGGCTTCGCACCTGCACAACGCGTCGCTGCTGCTGGATGACAT
AGAGGATGATTCGCCGTTGCGACGGGGGAAGCCCTCGGCTCATCGGGTGTTTGGACGCTCTCAGACGATTAATTC
TGCGAATTTTCTGTATCTCATGGCTGTGGAAGAGGTGTTTTTTCTGAGCGACGAGTCTCGTCGTATCTTTACCGG
TTAGTTAGCTGTCAAGCTGCTTGAATGGTTGGCAACTAACATCACTGACAGACGAGTTGAGAAACCTTCACGTTG
GGCAGAGCTATGATCTCTACTGGACGCAGACGAATCACTGCCCTTCTTTCAGCGAATACTACGACATGGTTCGCC
TAAGTGCGTTTTCTCGCGTGCTAATACATTCAACTTCTTGTCATTGCTGATAAGCCCGATCTGTACATAAGAGAC
GGGGAGCCTGTTCTGTATGATTGGTTGCCTAGTCCTCGCCGAAGCAAAAGAACCGAGGTATCAACACTCGCCGTC
TCTAAAGTTACTGTCTAATTGCTCTTAGAAGCATCCAGCGTGCAGATCTGTGCGACTTCCTGACTGTCCTCGGGC
AATTCTTCCAAATCCGCGACGATTACATCAACCTAACCTCAGACAAGGTCCGTTTCTGCAACACGCCCACAAACA
GTTCTAACAACCGCCGTAGTATGAGAAGCAAAAAGGCATCGCAGAAGACTTGGACGAGGGAAAACGCTCCTTTCC
TCTCATCCACCTCTTAACCAACTCCCCCGACCGCGCTATGATGGAGAGCATTCTACAGCAGCGATGGCAAGAGGG
AAGCATGTCCGCCGACTTGAAGGAGCTGGTGCTGGAGAAGATGGAAGAGGCCGGCAGCCTGGCCTACACTAAGAG
AATCCTGGATTCTTTCTCAGATAGGGCCAGGACATTGCTTGCTGGTCTTGAAGAGCAGGCGGGAAGCAACAACTA
CATTCTTCGCTATCTGATTGAGCGCTTGGCAGATTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail