Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1825
Gene name
LocationContig_180:4287..6420
Strand-
Gene length (bp)2133
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.2E-13 121 240
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.2E-10 122 382
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.4E-09 122 225

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.771119

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 204 226 22
3 236 258 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|129
Ophiocordyceps australis 1348a (Ghana) OphauG2|4186
Ophiocordyceps australis map64 (Brazil) OphauB2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|6352
Ophiocordyceps camponoti-floridani Ophcf2|00448
Ophiocordyceps camponoti-rufipedis Ophun1|1825 (this protein)
Ophiocordyceps kimflemingae Ophio5|6661
Ophiocordyceps subramaniannii Hirsu2|2771
Ophiocordyceps subramaniannii Hirsu2|7207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1825
MKLFIAAAFCFAGLSLAQPVHEDAVVAETKLRPLCHVWEMDRFSPATAFALVAVAASLLLLTSAARRRNQRVLPG
PPRLLLGGEHKHQLVYQPDSLPGARDVDTPYGCVRVYEFGPDDGPKVLLVHGITTPCLPLAPLAHALVHRGCRVM
LFDLFGRGFSDGVGDLPHDARLYVSQMLCVLASSPLPWTGQGAFRLIGYSMGGAIAIHFAIAFPHLVGSLVLLAP
AGLIRFDAYTSVARRLALAGAVPEFLLAAYAAFRLRTPLSTRASASRPAVAVAAAEAEVSSLGSTRVPLEDSISD
YVRWMIGHHPGFVPAFLSCMRDAPLNEQHEAWRRLATRPPRSTAVLLAEDDELISPAIYAREGLPLAGGPDRVVW
KVLPGTHDFIMTHVGPILDELDSLWQMKKPA*
Coding >Ophun1|1825
ATGAAGCTCTTCATCGCCGCCGCCTTCTGCTTTGCCGGTCTCTCGCTTGCGCAGCCGGTACATGAAGACGCTGTG
GTGGCAGAGACCAAGCTACGTCCACTATGTCATGTTTGGGAGATGGACCGCTTCTCTCCCGCCACCGCCTTCGCC
CTCGTCGCCGTCGCCGCCTCGCTGCTCCTCCTGACTTCAGCCGCCCGACGACGGAACCAGCGGGTGCTCCCCGGA
CCGCCTCGGCTGCTGCTGGGAGGCGAGCACAAGCACCAGCTCGTCTACCAGCCGGATTCGCTGCCCGGGGCGAGA
GACGTCGATACTCCGTACGGCTGCGTCCGCGTCTACGAGTTCGGCCCCGACGACGGACCCAAGGTGCTGCTCGTT
CACGGCATCACGACGCCCTGTCTTCCCCTGGCGCCTCTGGCTCACGCCCTGGTCCATCGCGGATGTCGCGTCATG
CTGTTTGACCTCTTCGGTCGAGGCTTCTCAGACGGTGTCGGCGACCTCCCTCACGATGCCCGCCTCTACGTCTCC
CAGATGCTCTGTGTCCTCGCCTCCAGTCCCCTGCCCTGGACCGGTCAAGGCGCGTTCCGTCTCATCGGCTACTCC
ATGGGCGGTGCCATCGCCATCCACTTTGCCATCGCCTTCCCCCATCTCGTCGGCTCTCTGGTTCTGCTCGCCCCG
GCAGGCCTCATCCGCTTCGATGCCTACACCTCGGTTGCTCGTCGTCTCGCCCTCGCTGGCGCTGTGCCCGAGTTC
CTCCTCGCCGCCTACGCCGCCTTCCGTCTGCGCACCCCTCTGTCCACGCGTGCTTCCGCTTCGAGGCCGGCCGTT
GCCGTGGCCGCTGCCGAAGCTGAAGTCTCCTCTTTAGGCTCTACCCGCGTGCCTCTCGAGGACAGCATCTCCGAC
TACGTCCGCTGGATGATTGGCCATCACCCCGGCTTCGTCCCAGCCTTCCTATCCTGCATGCGCGACGCGCCTCTC
AACGAGCAGCACGAAGCCTGGCGCCGTCTCGCCACGAGGCCGCCGCGGTCCACTGCCGTCTTGCTCGCCGAGGAC
GATGAGCTCATCAGTCCTGCCATCTACGCCCGTGAAGGTCTGCCACTGGCTGGCGGACCTGATCGTGTTGTCTGG
AAGGTCCTGCCAGGGACTCACGACTTTATCATGACCCATGTTGGCCCCATCCTCGACGAGCTGGACTCGTTGTGG
CAGATGAAGAAGCCGGCTTAG
Transcript >Ophun1|1825
ATGAAGCTCTTCATCGCCGCCGCCTTCTGCTTTGCCGGTCTCTCGCTTGCGCAGCCGGTACATGAAGACGCTGTG
GTGGCAGAGACCAAGCTACGTCCACTATGTCATGTTTGGGAGATGGACCGCTTCTCTCCCGCCACCGCCTTCGCC
CTCGTCGCCGTCGCCGCCTCGCTGCTCCTCCTGACTTCAGCCGCCCGACGACGGAACCAGCGGGTGCTCCCCGGA
CCGCCTCGGCTGCTGCTGGGAGGCGAGCACAAGCACCAGCTCGTCTACCAGCCGGATTCGCTGCCCGGGGCGAGA
GACGTCGATACTCCGTACGGCTGCGTCCGCGTCTACGAGTTCGGCCCCGACGACGGACCCAAGGTGCTGCTCGTT
CACGGCATCACGACGCCCTGTCTTCCCCTGGCGCCTCTGGCTCACGCCCTGGTCCATCGCGGATGTCGCGTCATG
CTGTTTGACCTCTTCGGTCGAGGCTTCTCAGACGGTGTCGGCGACCTCCCTCACGATGCCCGCCTCTACGTCTCC
CAGATGCTCTGTGTCCTCGCCTCCAGTCCCCTGCCCTGGACCGGTCAAGGCGCGTTCCGTCTCATCGGCTACTCC
ATGGGCGGTGCCATCGCCATCCACTTTGCCATCGCCTTCCCCCATCTCGTCGGCTCTCTGGTTCTGCTCGCCCCG
GCAGGCCTCATCCGCTTCGATGCCTACACCTCGGTTGCTCGTCGTCTCGCCCTCGCTGGCGCTGTGCCCGAGTTC
CTCCTCGCCGCCTACGCCGCCTTCCGTCTGCGCACCCCTCTGTCCACGCGTGCTTCCGCTTCGAGGCCGGCCGTT
GCCGTGGCCGCTGCCGAAGCTGAAGTCTCCTCTTTAGGCTCTACCCGCGTGCCTCTCGAGGACAGCATCTCCGAC
TACGTCCGCTGGATGATTGGCCATCACCCCGGCTTCGTCCCAGCCTTCCTATCCTGCATGCGCGACGCGCCTCTC
AACGAGCAGCACGAAGCCTGGCGCCGTCTCGCCACGAGGCCGCCGCGGTCCACTGCCGTCTTGCTCGCCGAGGAC
GATGAGCTCATCAGTCCTGCCATCTACGCCCGTGAAGGTCTGCCACTGGCTGGCGGACCTGATCGTGTTGTCTGG
AAGGTCCTGCCAGGGACTCACGACTTTATCATGACCCATGTTGGCCCCATCCTCGACGAGCTGGACTCGTTGTGG
CAGATGAAGAAGCCGGCTTAG
Gene >Ophun1|1825
ATGAAGCTCTTCATCGCCGCCGCCTTCTGCTTTGCCGGTCTCTCGCTTGCGCAGCCGGTACATGTAAGTCTATCC
ACGCCACGCAAACACCAAGCCCATCTCAGTCTCACAATGCAGGGAACCGTTGCGGGAGTCGAGCCCCGAAGCGAG
CATCAAGTGTCGACGCCGTTGCAACTGTTGCGTCGGGCTAGGGGATCTGAATGCTTCCCTGCCACTTGTCACTCT
GCTTCGGATTGCGGGCGTGGATGCAGTCGATGCTACCAGGCAAACAAGGGAGATTTGGGACGCTGCTATGCTTGA
ATAGTAGGTTTCTAGTTGGACGGGATACATGTACGTTGGATAGCTTGATATTTGTAGGGTTTTTGGATATTCCTT
TAACAATAACAGCTGCCAGGAAGACGCTGTGGTGGCAGAGACCAAGCTACGTCCACTATGTCATGTTTGGGGTGA
GACATGGGCACAGAACAGGAGAGGACGATTCCGTCTCAGATGCTTCCGTCCAGCTACAATTCCATTGCGCGTGGA
ATGTAGAGACAGCCGAGGTTTCCGACAAGGAGGCCGCCCTTGACCGTTGACGGAGAAGAGTCCCCATATAGAACC
TGGTATGGATTCGTTGGAGACAATCTAGGATCGTGACTTGTAGCAGGACCCTGAGGCAGCTCCGAGTACGAGAAC
AGTAGGGTAGTCTCTTGGAGGGCCTACCAGAGTCCTACTGCGAATGCCTATCTAGAGAGAGCCTTTGTTTGGACA
TTTTGCAGTCAGTACCGACTTGAGAAATCCGCACAGTACGCACGAAGCACTGACCTATAGGATACTAGTAGGTAG
CTTCCTGCAACAACCGCCAACCGCCAACCGCCAAAACAAAACAAAACACCAAGCCTCAACAGAGGCTCAACGGAG
ACAGGCAGAGATGGACCGCTTCTCTCCCGCCACCGCCTTCGCCCTCGTCGCCGTCGCCGCCTCGCTGCTCCTCCT
GACTTCAGCCGCCCGACGACGGAACCAGCGGGTGCTCCCCGGACCGCCTCGGCTGCTGCTGGGAGGCGAGCACAA
GCACCAGCTCGTCTACCAGCCGGATTCGCTGCCCGGGGCGAGAGACGTCGATACTCCGGTAAGGCTGGGCCTGCT
GGGAGGCTGACGAGACGGAGGCTGACGGCGCTGCAGTACGGCTGCGTCCGCGTCTACGAGTTCGGCCCCGACGAC
GGACCCAAGGTGCTGCTCGTTCACGGCATCACGACGCCCTGTCTTCCCCTGGCGCCTCTGGCTCACGCCCTGGTC
CATCGCGGATGTCGCGTCATGCTGTTTGTGAGCCTCCATCTACCTATCCATCCCCTTCCATCTAACCCCCTTCGC
CCCTGCTGACGTCCTCAGGACCTCTTCGGTCGAGGCTTCTCAGACGGTGTCGGCGACCTCCCTCACGATGCCCGC
CTCTACGTCTCCCAGATGCTCTGTGTCCTCGCCTCCAGTCCCCTGCCCTGGACCGGTCAAGGCGCGTTCCGTCTC
ATCGGCTACTCCATGGGCGGTGCCATCGCCATCCACTTTGCCATCGCCTTCCCCCATCTCGTCGGCTCTCTGGTT
CTGCTCGCCCCGGCAGGCCTCATCCGCTTCGATGCCTACACCTCGGTTGCTCGTCGTCTCGCCCTCGCTGGCGCT
GTGCCCGAGTTCCTCCTCGCCGCCTACGCCGCCTTCCGTCTGCGCACCCCTCTGTCCACGCGTGCTTCCGCTTCG
AGGCCGGCCGTTGCCGTGGCCGCTGCCGAAGCTGAAGTCTCCTCTTTAGGCTCTACCCGCGTGCCTCTCGAGGAC
AGCATCTCCGACTACGTCCGCTGGATGATTGGCCATCACCCCGGCTTCGTCCCAGCCTTCCTATCCTGCATGCGC
GACGCGCCTCTCAACGAGCAGCACGAAGCCTGGCGCCGTCTCGCCACGAGGCCGCCGCGGTCCACTGCCGTCTTG
CTCGCCGAGGACGATGAGCTCATCAGTCCTGCCATCTACGCCCGTGAAGGTCTGCCACTGGCTGGCGGACCTGAT
CGTGTTGTCTGGAAGGTCCTGCCAGGGACTCACGACTTTATCATGACCCATGTTGGCCCCATCCTCGACGAGCTG
GACTCGTTGTGGCAGATGAAGAAGCCGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail