Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1819
Gene name
LocationContig_18:56972..59139
Strand-
Gene length (bp)2167
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 1.3E-08 275 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 206 538 7.0E-18
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 206 657 2.0E-14
sp|O62852|TRPC5_RABIT Short transient receptor potential channel 5 OS=Oryctolagus cuniculus GN=TRPC5 PE=2 SV=1 194 527 6.0E-09
sp|Q9QX29|TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus GN=Trpc5 PE=1 SV=2 194 527 8.0E-09
sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 194 527 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 206 538 7.0E-18
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 206 657 2.0E-14
sp|O62852|TRPC5_RABIT Short transient receptor potential channel 5 OS=Oryctolagus cuniculus GN=TRPC5 PE=2 SV=1 194 527 6.0E-09
sp|Q9QX29|TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus GN=Trpc5 PE=1 SV=2 194 527 8.0E-09
sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 194 527 9.0E-09
sp|Q9R283|TRPC2_RAT Short transient receptor potential channel 2 OS=Rattus norvegicus GN=Trpc2 PE=2 SV=2 187 542 1.0E-06
sp|Q9UBN4|TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens GN=TRPC4 PE=1 SV=1 300 527 5.0E-06
sp|P79100|TRPC4_BOVIN Short transient receptor potential channel 4 OS=Bos taurus GN=TRPC4 PE=2 SV=2 300 527 5.0E-06
sp|Q9QUQ5|TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus GN=Trpc4 PE=1 SV=1 300 527 6.0E-06
sp|O35119|TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus GN=Trpc4 PE=1 SV=2 300 527 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity No
GO:0005215 transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 275 292 17
2 333 355 22
3 375 397 22
4 404 426 22
5 465 487 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1819
MPIRVKSKRPPPVREPSPVSTRDDFEMPEIDAKDSFRQVAAKLSAYFVDAIDMPHSFEQLRTTVAGNCIRDLVDH
LHDHNLNLATVHALLALKWHYAAAHEHAGLNQARSYACEIVAWRFLTRLSEHEVMDCCLYEIPDAVEDATPQLDI
EALETAPLLPRATFPSHAVGSSAKRMQLQGSLYRLAAQGDGEGNDNLDPTSAFMGLNALEIAAVADAKRFLSQSV
VQKIVSGIWNGDIVFWDSLSVHATKKPRFYDPNTADPFSRLRVPKYLKSWEVLFFAVFLGLYYMVLVSRVESHIT
AAEAVLLIWIAAFAYDELSEWLDAGFIFYATDIWNLFDITMILIGSVFATLIGLLRGDDNLTSLAFDVLSLEALF
MMPRICSILSLSPYWGTLVPCLKEMGRDFFKFMVLVFIVYLGFLTTFSLVGRDSFPFSKMTGILTSIFFGSSSVG
LDIMSEIDPIFGPPLMLIFVTLTSILLMGSLTGMLSNSFSRVITHAKEEYLYVYSVYVLEASTSNRLTHFYPPFN
LVALIVFRPFRIICFSTKHETFRTGRIWLLKMTHLPVVMAIQFYEFLQRKLSRKSNRPVLKGPQSRERRPQRSRA
TTLSNYNRPQIASREVRKEDTRDEDEAEAPTLLEAQVAELSEKIDRLLEMVQASREGNGRD*
Coding >Ophun1|1819
ATGCCGATCCGCGTCAAGTCAAAGCGGCCTCCGCCGGTGCGCGAGCCGAGCCCCGTCTCAACTCGCGATGACTTC
GAGATGCCGGAGATAGACGCCAAGGATTCGTTTCGTCAGGTGGCCGCCAAGCTATCAGCCTACTTTGTCGATGCC
ATTGATATGCCTCACAGTTTCGAGCAGCTCAGGACTACTGTTGCCGGCAACTGTATCCGTGACCTTGTCGACCAC
CTGCACGATCACAACCTGAATCTGGCCACCGTTCACGCCCTCCTCGCCCTCAAGTGGCACTACGCCGCCGCCCAT
GAGCACGCCGGACTGAACCAGGCGCGCTCCTATGCCTGCGAGATCGTCGCCTGGCGCTTCCTCACTCGTCTCTCA
GAACACGAGGTCATGGACTGTTGCCTCTACGAGATTCCCGACGCTGTCGAAGATGCCACGCCGCAGCTCGACATC
GAGGCTTTGGAGACGGCGCCTCTGCTGCCTCGGGCTACCTTTCCGTCGCACGCAGTAGGCAGCTCGGCCAAGCGG
ATGCAATTGCAGGGATCTCTATACCGTCTCGCGGCTCAGGGCGATGGCGAAGGCAACGATAACCTCGATCCAACC
TCGGCCTTCATGGGCCTCAACGCTCTCGAAATCGCCGCCGTAGCCGATGCCAAGCGTTTCCTCAGCCAGTCTGTG
GTGCAGAAGATTGTCAGCGGCATCTGGAACGGCGACATCGTCTTTTGGGACTCGTTGTCGGTTCATGCTACCAAG
AAACCTCGCTTCTACGATCCTAATACAGCGGATCCCTTCTCTCGTCTACGCGTCCCGAAATACCTCAAGAGCTGG
GAGGTTCTGTTCTTCGCCGTCTTCCTCGGTCTTTACTACATGGTTCTAGTCTCTCGCGTGGAGAGCCACATTACA
GCTGCGGAGGCCGTCTTGCTCATTTGGATTGCTGCCTTTGCCTACGATGAGCTTAGCGAGTGGCTTGATGCTGGC
TTCATCTTTTACGCGACCGACATCTGGAATCTATTCGACATTACCATGATCCTCATTGGCTCTGTCTTTGCCACT
CTCATCGGGCTCCTTCGCGGCGACGACAACCTCACGAGTCTAGCCTTTGACGTGCTCTCTCTCGAGGCTCTTTTC
ATGATGCCGCGCATCTGCTCCATCCTGAGCTTGAGCCCGTACTGGGGAACACTAGTTCCTTGTCTCAAAGAAATG
GGCCGGGACTTTTTCAAATTCATGGTCCTAGTCTTCATTGTCTATCTCGGCTTCTTGACCACCTTTTCCCTCGTC
GGACGCGACTCGTTCCCCTTTTCCAAAATGACGGGCATCTTGACCAGTATCTTCTTCGGCTCCAGCTCTGTCGGG
CTCGACATCATGAGCGAGATCGATCCCATCTTCGGGCCGCCCCTGATGCTCATATTCGTCACCCTCACGTCGATC
CTCCTCATGGGTTCCCTGACGGGTATGCTGTCCAACAGCTTCTCACGCGTCATAACGCATGCAAAAGAGGAGTAC
CTCTACGTCTACAGCGTCTATGTCCTCGAGGCATCGACGAGCAACCGGCTTACCCACTTCTACCCGCCCTTCAAC
CTCGTCGCCTTGATCGTCTTCCGTCCGTTCCGGATCATCTGTTTCTCAACTAAGCATGAGACATTCCGCACCGGT
CGAATCTGGCTGCTAAAGATGACGCACCTCCCCGTCGTCATGGCCATCCAGTTCTACGAATTCCTCCAGCGCAAG
CTCTCCAGGAAGTCGAACCGGCCCGTCCTGAAAGGCCCGCAGAGTAGGGAACGCAGGCCGCAGAGATCGCGGGCG
ACGACACTGTCCAACTACAACAGGCCCCAAATCGCCTCGAGGGAGGTGCGGAAGGAGGATACGCGGGACGAGGAT
GAGGCTGAGGCACCGACGCTTTTGGAGGCGCAGGTTGCCGAGTTGAGTGAGAAGATTGATAGGCTGTTGGAGATG
GTGCAGGCGAGTCGGGAGGGCAACGGCAGAGACTGA
Transcript >Ophun1|1819
ATGCCGATCCGCGTCAAGTCAAAGCGGCCTCCGCCGGTGCGCGAGCCGAGCCCCGTCTCAACTCGCGATGACTTC
GAGATGCCGGAGATAGACGCCAAGGATTCGTTTCGTCAGGTGGCCGCCAAGCTATCAGCCTACTTTGTCGATGCC
ATTGATATGCCTCACAGTTTCGAGCAGCTCAGGACTACTGTTGCCGGCAACTGTATCCGTGACCTTGTCGACCAC
CTGCACGATCACAACCTGAATCTGGCCACCGTTCACGCCCTCCTCGCCCTCAAGTGGCACTACGCCGCCGCCCAT
GAGCACGCCGGACTGAACCAGGCGCGCTCCTATGCCTGCGAGATCGTCGCCTGGCGCTTCCTCACTCGTCTCTCA
GAACACGAGGTCATGGACTGTTGCCTCTACGAGATTCCCGACGCTGTCGAAGATGCCACGCCGCAGCTCGACATC
GAGGCTTTGGAGACGGCGCCTCTGCTGCCTCGGGCTACCTTTCCGTCGCACGCAGTAGGCAGCTCGGCCAAGCGG
ATGCAATTGCAGGGATCTCTATACCGTCTCGCGGCTCAGGGCGATGGCGAAGGCAACGATAACCTCGATCCAACC
TCGGCCTTCATGGGCCTCAACGCTCTCGAAATCGCCGCCGTAGCCGATGCCAAGCGTTTCCTCAGCCAGTCTGTG
GTGCAGAAGATTGTCAGCGGCATCTGGAACGGCGACATCGTCTTTTGGGACTCGTTGTCGGTTCATGCTACCAAG
AAACCTCGCTTCTACGATCCTAATACAGCGGATCCCTTCTCTCGTCTACGCGTCCCGAAATACCTCAAGAGCTGG
GAGGTTCTGTTCTTCGCCGTCTTCCTCGGTCTTTACTACATGGTTCTAGTCTCTCGCGTGGAGAGCCACATTACA
GCTGCGGAGGCCGTCTTGCTCATTTGGATTGCTGCCTTTGCCTACGATGAGCTTAGCGAGTGGCTTGATGCTGGC
TTCATCTTTTACGCGACCGACATCTGGAATCTATTCGACATTACCATGATCCTCATTGGCTCTGTCTTTGCCACT
CTCATCGGGCTCCTTCGCGGCGACGACAACCTCACGAGTCTAGCCTTTGACGTGCTCTCTCTCGAGGCTCTTTTC
ATGATGCCGCGCATCTGCTCCATCCTGAGCTTGAGCCCGTACTGGGGAACACTAGTTCCTTGTCTCAAAGAAATG
GGCCGGGACTTTTTCAAATTCATGGTCCTAGTCTTCATTGTCTATCTCGGCTTCTTGACCACCTTTTCCCTCGTC
GGACGCGACTCGTTCCCCTTTTCCAAAATGACGGGCATCTTGACCAGTATCTTCTTCGGCTCCAGCTCTGTCGGG
CTCGACATCATGAGCGAGATCGATCCCATCTTCGGGCCGCCCCTGATGCTCATATTCGTCACCCTCACGTCGATC
CTCCTCATGGGTTCCCTGACGGGTATGCTGTCCAACAGCTTCTCACGCGTCATAACGCATGCAAAAGAGGAGTAC
CTCTACGTCTACAGCGTCTATGTCCTCGAGGCATCGACGAGCAACCGGCTTACCCACTTCTACCCGCCCTTCAAC
CTCGTCGCCTTGATCGTCTTCCGTCCGTTCCGGATCATCTGTTTCTCAACTAAGCATGAGACATTCCGCACCGGT
CGAATCTGGCTGCTAAAGATGACGCACCTCCCCGTCGTCATGGCCATCCAGTTCTACGAATTCCTCCAGCGCAAG
CTCTCCAGGAAGTCGAACCGGCCCGTCCTGAAAGGCCCGCAGAGTAGGGAACGCAGGCCGCAGAGATCGCGGGCG
ACGACACTGTCCAACTACAACAGGCCCCAAATCGCCTCGAGGGAGGTGCGGAAGGAGGATACGCGGGACGAGGAT
GAGGCTGAGGCACCGACGCTTTTGGAGGCGCAGGTTGCCGAGTTGAGTGAGAAGATTGATAGGCTGTTGGAGATG
GTGCAGGCGAGTCGGGAGGGCAACGGCAGAGACTGA
Gene >Ophun1|1819
ATGCCGATCCGCGTCAAGTCAAAGCGGCCTCCGCCGGTGCGCGAGCCGAGCCCCGTCTCAACTCGCGATGACTTC
GAGATGCCGGAGATAGACGCCAAGGATTCGTTTCGTCAGGTGGCCGCCAAGCTATCAGCGTTCGTCTTCATTACC
CATATCTTCATCGTTGAAGCTCTTGATTGCTAGCTGATGGCCCCCTTTCAGCTACTTTGTCGATGCCATTGATAT
GCCTCACAGTTTCGAGCAGCTCAGGACTACTGTTGCCGGCAACTGTATCCGTGACCTTGTCGACCACCTGCACGA
TCACAACCTGAATCTGGCCACCGTTCACGCCCTCCTGTGAGCCCCTTCTTCTGATCTCAGCCCATCATCTCCAGC
TCATGTCCCGACACAGCGCCCTCAAGTGGCACTACGCCGCCGCCCATGAGCACGCCGGACTGAACCAGGCGCGCT
CCTATGCCTGCGAGATCGTCGCCTGGCGCTTCCTCACTCGTCTCTCAGAACACGAGGTCATGGACTGTTGCCTCT
ACGAGATTCCCGACGCTGTCGAAGATGCCACGCCGCAGCTCGACATCGAGGCTTTGGAGACGGCGCCTCTGCTGC
CTCGGGCTACCTTTCCGTCGCACGCAGTAGGCAGCTCGGCCAAGCGGATGCAATTGCAGGGATCTCTATACCGTC
TCGCGGCTCAGGGCGATGGCGAAGGCAACGATAACCTCGATCCAACCTCGGCCTTCATGGGCCTCAACGCTCTCG
AAATCGCCGCCGTAGCCGATGCCAAGCGTTTCCTCAGCCAGTCTGTGGTGCAGAAGATTGTCAGCGGCATCTGGA
ACGGCGACATCGTCTTTTGGGACTCGTTGTCGGTTCATGCTACCAAGAAACCTCGCTTCTACGATCCTAATACAG
CGGATCCCTTCTCTCGTCTACGCGTCCCGAAATACCTCAAGAGCTGGGAGGTTCTGTTCTTCGCCGTCTTCCTCG
GTCTTTACTACATGGTTCTAGTCTCTCGCGTGGAGAGCCACATTACAGCTGCGGAGGCCGTCTTGCTCATTTGGA
TTGCTGCCTTTGCCTACGATGAGCTTAGCGAGTGGCTTGATGCTGGCTTCATCTTTTACGCGACCGACATCTGGA
ATCTATTCGACATTACCATGATCCTCATTGGCTCTGTCTTTGCCACTCTCAGTCAGTAAAAAGGTGTCTGACGGC
TTTGTGTTGTTTACTGACACGTCTCACAGGGATAGTCGGGCTCCTTCGCGGCGACGACAACCTCACGAGTCTAGC
CTTTGACGTGCTCTCTCTCGAGGCTCTTTTCATGATGCCGCGCATCTGCTCCATCCTGAGCTTGAGCCCGTACTG
GGGAACACTAGTTCCTTGTCTCAAAGAAATGGGCCGGGACTTTTTCAAATTCATGGTCCTAGTCTTCATTGTCTA
TCTCGGCTTCTTGACCACCTTTTCCCTCGTCGGACGCGACTCGTTCCCCTTTTCCAAAATGACGGGCATCTTGAC
CAGTATCTTCTTCGGCTCCAGCTCTGTCGGGCTCGACATCATGAGCGAGATCGATCCCATCTTCGGGCCGCCCCT
GATGCTCATATTCGTCACCCTCACGTCGATCCTCCTCATGGGTTCCCTGACGGGTATGCTGTCCAACAGCTTCTC
ACGCGTCATAACGCATGCAAAAGAGGAGTACCTCTACGTCTACAGCGTCTATGTCCTCGAGGCATCGACGAGCAA
CCGGCTTACCCACTTCTACCCGCCCTTCAACCTCGTCGCCTTGATCGTCTTCCGTCCGTTCCGGATCATCTGTTT
CTCAACTAAGCATGAGACATTCCGCACCGGTCGAATCTGGCTGCTAAAGATGACGCACCTCCCCGTCGTCATGGC
CATCCAGTTCTACGAATTCCTCCAGCGCAAGCTCTCCAGGAAGTCGAACCGGCCCGTCCTGAAAGGCCCGCAGAG
TAGGGAACGCAGGCCGCAGAGATCGCGGGCGACGACACTGTCCAACTACAACAGGCCCCAAATCGCCTCGAGGGA
GGTGCGGAAGGAGGATACGCGGGACGAGGATGAGGCTGAGGCACCGACGCTTTTGGAGGCGCAGGTTGCCGAGTT
GAGTGAGAAGATTGATAGGCTGTTGGAGATGGTGCAGGCGAGTCGGGAGGGCAACGGCAGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail