Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1818
Gene name
LocationContig_18:54576..56560
Strand+
Gene length (bp)1984
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 7.5E-87 34 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 51 600 1.0E-115
sp|Q9H6U8|ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens GN=ALG9 PE=1 SV=2 30 581 1.0E-105
sp|Q8VDI9|ALG9_MOUSE Alpha-1,2-mannosyltransferase ALG9 OS=Mus musculus GN=Alg9 PE=2 SV=1 30 581 2.0E-105
sp|P54002|YTH3_CAEEL Putative glycosyltransferase C14A4.3 OS=Caenorhabditis elegans GN=C14A4.3 PE=1 SV=2 2 602 4.0E-87
sp|Q9FZ49|ALG9_ARATH Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana GN=ALG9 PE=1 SV=1 51 599 3.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 51 600 1.0E-115
sp|Q9H6U8|ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens GN=ALG9 PE=1 SV=2 30 581 1.0E-105
sp|Q8VDI9|ALG9_MOUSE Alpha-1,2-mannosyltransferase ALG9 OS=Mus musculus GN=Alg9 PE=2 SV=1 30 581 2.0E-105
sp|P54002|YTH3_CAEEL Putative glycosyltransferase C14A4.3 OS=Caenorhabditis elegans GN=C14A4.3 PE=1 SV=2 2 602 4.0E-87
sp|Q9FZ49|ALG9_ARATH Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana GN=ALG9 PE=1 SV=1 51 599 3.0E-70
sp|P53868|ALG9_YEAST Alpha-1,2-mannosyltransferase ALG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG9 PE=1 SV=1 51 599 4.0E-68
sp|Q5AK24|GPI10_CANAL GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI10 PE=3 SV=1 53 365 1.0E-10
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 55 373 8.0E-09
sp|Q92521|PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens GN=PIGB PE=2 SV=1 15 373 1.0E-08
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 55 374 2.0E-08
sp|Q9VZM5|PIGB_DROME GPI mannosyltransferase 3 OS=Drosophila melanogaster GN=CG12006 PE=2 SV=2 29 386 7.0E-07
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 55 363 8.0E-07
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 55 381 1.0E-06
sp|P30777|GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI10 PE=1 SV=2 34 373 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 113 135 22
3 142 164 22
4 168 187 19
5 194 216 22
6 236 258 22
7 296 315 19
8 330 349 19
9 361 383 22
10 398 420 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1818
MAPPQPSAQFEHSATTHAKRKKRHGPYPLEPITVFYFFLAANVAAALWAPIQDCDETFNYWEPTHYLSRGYGLQT
WEYSPDYAIRSWLYIALHAVVGTARRILPHSSKVSEFYFVRYALAFVCALCQTILFKAICLSLNARVAVFFILAT
ISSPGNFHASTAFLPSSFAMYTAMLGAACFMNWRGGLKTSRGIFWFAVGAILGWPFAAALCAPFIVEEVVLAVFS
DAQATFEAFVRLFRGGVAGLLVLLADFLVNFFFYRKATIVTWNIIKYNIFSSTGGPELYGTEPWHFYLKNLALNF
NMWFALALLALPIFLLQKAFSSSGHGFQSGLRTVVFIAPFYMWLAIFTAQPHKEERFMYPLYPFLALNASISLHM
ILSALGRAGSRTLIGRIPGRLKLLGAGLVLLSSLILGLSRIYGVYSAYSAPLRIYQPLWGDFKGNNATGNPEDPV
CFGKDWYRFPTSYFLPRGMHAKFIRSDFHGLLPGEFSQAKTGFGLWSGTWLPTRGLNNANKEDATTYVDVRACAL
LVDTQYPDRAHPPPPSPNEPDYAADAGTWAVVRCEPFLDAAATHLVARALWVPDLAIVPQRLRRKWGRHCLLQRR
RN*
Coding >Ophun1|1818
ATGGCGCCGCCCCAACCCTCAGCGCAGTTCGAGCACTCGGCAACCACCCATGCCAAGAGGAAGAAGCGGCACGGG
CCGTACCCCCTCGAGCCCATCACCGTCTTCTACTTCTTCCTGGCTGCCAACGTTGCGGCCGCGTTATGGGCACCT
ATTCAAGACTGCGATGAAACCTTCAACTACTGGGAGCCTACCCACTACCTCTCTCGCGGCTATGGCCTCCAGACG
TGGGAGTATTCTCCCGACTATGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGGACCGCACGC
CGGATCCTTCCGCACTCATCCAAGGTTTCCGAGTTCTACTTCGTACGCTACGCACTCGCCTTCGTCTGCGCCCTC
TGCCAGACAATCCTCTTCAAAGCCATCTGCCTATCCCTCAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACC
ATCTCCAGCCCCGGAAACTTCCACGCAAGCACCGCATTCCTGCCCTCGAGCTTCGCCATGTACACGGCCATGCTG
GGCGCCGCCTGTTTCATGAACTGGCGTGGCGGGCTCAAGACATCGCGCGGCATCTTCTGGTTTGCCGTGGGCGCC
ATTCTTGGCTGGCCTTTTGCCGCTGCTCTTTGCGCGCCTTTTATCGTTGAGGAGGTAGTCCTCGCTGTCTTTAGC
GATGCGCAGGCCACTTTTGAGGCCTTTGTTCGCCTTTTTCGCGGTGGTGTTGCGGGCCTACTCGTTCTGCTCGCC
GACTTTCTCGTCAACTTCTTCTTCTACCGCAAAGCGACAATCGTCACATGGAACATCATCAAGTACAACATCTTC
TCGTCCACCGGCGGCCCCGAGCTATACGGCACCGAGCCCTGGCACTTTTACCTCAAGAACCTAGCCCTCAACTTC
AACATGTGGTTCGCCCTGGCTCTACTGGCGCTGCCCATCTTCCTCCTCCAAAAAGCCTTCTCGTCGTCCGGCCAC
GGCTTCCAATCCGGGTTGCGCACCGTCGTCTTCATCGCCCCCTTTTACATGTGGCTCGCCATCTTCACGGCCCAG
CCGCACAAGGAAGAGCGATTCATGTACCCGCTCTACCCCTTCCTCGCCCTCAACGCGTCCATATCCCTGCACATG
ATTCTATCTGCCTTGGGTCGCGCAGGCTCAAGGACGCTGATAGGCAGGATCCCCGGACGACTCAAACTCCTCGGC
GCGGGTCTCGTCCTACTTTCATCACTGATTCTCGGACTATCGCGCATCTACGGCGTCTACTCAGCCTACAGTGCC
CCCTTACGCATCTACCAACCCCTATGGGGCGACTTCAAAGGCAACAACGCGACCGGCAACCCCGAAGACCCAGTC
TGCTTCGGCAAAGACTGGTACCGCTTCCCAACATCCTACTTCCTCCCCCGCGGCATGCACGCCAAGTTCATCCGC
TCCGACTTCCACGGCCTCCTCCCCGGCGAGTTCTCCCAAGCAAAGACCGGCTTCGGCCTCTGGAGCGGCACCTGG
CTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTACGTCGACGTCCGCGCCTGCGCCCTC
CTCGTCGACACGCAGTACCCAGACCGCGCCCACCCACCACCGCCCTCGCCCAACGAGCCCGACTACGCCGCTGAC
GCGGGCACGTGGGCCGTCGTCAGGTGCGAGCCCTTTCTCGACGCGGCGGCCACGCACCTCGTCGCCCGCGCGCTT
TGGGTGCCGGACCTGGCGATTGTGCCGCAGAGGTTGAGGAGGAAATGGGGGCGGCACTGTCTGCTGCAGAGGCGG
AGGAATTGA
Transcript >Ophun1|1818
ATGGCGCCGCCCCAACCCTCAGCGCAGTTCGAGCACTCGGCAACCACCCATGCCAAGAGGAAGAAGCGGCACGGG
CCGTACCCCCTCGAGCCCATCACCGTCTTCTACTTCTTCCTGGCTGCCAACGTTGCGGCCGCGTTATGGGCACCT
ATTCAAGACTGCGATGAAACCTTCAACTACTGGGAGCCTACCCACTACCTCTCTCGCGGCTATGGCCTCCAGACG
TGGGAGTATTCTCCCGACTATGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGGACCGCACGC
CGGATCCTTCCGCACTCATCCAAGGTTTCCGAGTTCTACTTCGTACGCTACGCACTCGCCTTCGTCTGCGCCCTC
TGCCAGACAATCCTCTTCAAAGCCATCTGCCTATCCCTCAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACC
ATCTCCAGCCCCGGAAACTTCCACGCAAGCACCGCATTCCTGCCCTCGAGCTTCGCCATGTACACGGCCATGCTG
GGCGCCGCCTGTTTCATGAACTGGCGTGGCGGGCTCAAGACATCGCGCGGCATCTTCTGGTTTGCCGTGGGCGCC
ATTCTTGGCTGGCCTTTTGCCGCTGCTCTTTGCGCGCCTTTTATCGTTGAGGAGGTAGTCCTCGCTGTCTTTAGC
GATGCGCAGGCCACTTTTGAGGCCTTTGTTCGCCTTTTTCGCGGTGGTGTTGCGGGCCTACTCGTTCTGCTCGCC
GACTTTCTCGTCAACTTCTTCTTCTACCGCAAAGCGACAATCGTCACATGGAACATCATCAAGTACAACATCTTC
TCGTCCACCGGCGGCCCCGAGCTATACGGCACCGAGCCCTGGCACTTTTACCTCAAGAACCTAGCCCTCAACTTC
AACATGTGGTTCGCCCTGGCTCTACTGGCGCTGCCCATCTTCCTCCTCCAAAAAGCCTTCTCGTCGTCCGGCCAC
GGCTTCCAATCCGGGTTGCGCACCGTCGTCTTCATCGCCCCCTTTTACATGTGGCTCGCCATCTTCACGGCCCAG
CCGCACAAGGAAGAGCGATTCATGTACCCGCTCTACCCCTTCCTCGCCCTCAACGCGTCCATATCCCTGCACATG
ATTCTATCTGCCTTGGGTCGCGCAGGCTCAAGGACGCTGATAGGCAGGATCCCCGGACGACTCAAACTCCTCGGC
GCGGGTCTCGTCCTACTTTCATCACTGATTCTCGGACTATCGCGCATCTACGGCGTCTACTCAGCCTACAGTGCC
CCCTTACGCATCTACCAACCCCTATGGGGCGACTTCAAAGGCAACAACGCGACCGGCAACCCCGAAGACCCAGTC
TGCTTCGGCAAAGACTGGTACCGCTTCCCAACATCCTACTTCCTCCCCCGCGGCATGCACGCCAAGTTCATCCGC
TCCGACTTCCACGGCCTCCTCCCCGGCGAGTTCTCCCAAGCAAAGACCGGCTTCGGCCTCTGGAGCGGCACCTGG
CTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTACGTCGACGTCCGCGCCTGCGCCCTC
CTCGTCGACACGCAGTACCCAGACCGCGCCCACCCACCACCGCCCTCGCCCAACGAGCCCGACTACGCCGCTGAC
GCGGGCACGTGGGCCGTCGTCAGGTGCGAGCCCTTTCTCGACGCGGCGGCCACGCACCTCGTCGCCCGCGCGCTT
TGGGTGCCGGACCTGGCGATTGTGCCGCAGAGGTTGAGGAGGAAATGGGGGCGGCACTGTCTGCTGCAGAGGCGG
AGGAATTGA
Gene >Ophun1|1818
ATGGCGCCGCCCCAACCCTCAGCGCAGTTCGAGCACTCGGCAACCACCCATGCCAAGAGGAAGAAGTACGCCATT
CATTGGATTCATCTCTCTTAACTCTGCTCTCCCTCGCTAACGGCTCTCTAGGCGGCACGGGCCGTACCCCCTCGA
GCCCATCACCGTCTTCTACTTCTTCCTGGCTGCCAACGTTGCGGCCGCGTTATGGGCACCTATTCAAGACTGCGA
TGAAACCTTCAACTACTGGGAGCCTACCCACTACCTCTCTCGCGGCTATGGCCTCCAGACGTGGGAGTATTCTCC
CGACTATGCCATCCGCAGCTGGCTCTACATCGCCCTGCACGCCGTCGTGGGGACCGCACGCCGGATCCTTCCGCA
CTCATCCAAGGTGAGATCTTCACCCATATCATTTATATCTCTTCAATCACGGCTGAATGTTCGCCCCAGGTTTCC
GAGTTCTACTTCGTACGCTACGCACTCGCCTTCGTCTGCGCCCTCTGCCAGACAATCCTCTTCAAAGCCATCTGC
CTATCCCTCAACGCCCGCGTCGCCGTCTTCTTCATCCTCGCCACCATCTCCAGCCCCGGAAACTTCCACGCAAGC
ACCGCATTCCTGCCCTCGAGCTTCGCCATGTACACGGCCATGCTGGGCGCCGCCTGTTTCATGAACTGGCGTGGC
GGGCTCAAGACATCGCGCGGCATCTTCTGGTTTGCCGTGGGCGCCATTCTTGGCTGGCCTTTTGCCGCTGCTCTT
TGCGCGCCTTTTATCGTTGAGGAGGTAGTCCTCGCTGTCTTTAGCGATGCGCAGGCCACTTTTGAGGCCTTTGTT
CGCCTTTTTCGCGGTGGTGTTGCGGGCCTACTCGTTCTGGTGAGCGTGTGCGGGCAATAAGCTGGCCTGACAATC
TGAACTTACGCGCTTCCAGCTCGCCGACTTTCTCGTCAACTTCTTCTTCTACCGCAAAGCGACAATCGTCACATG
GAACATCATCAAGTACAACATCTTCTCGTCCACCGGCGGCCCCGAGCTATACGGCACCGAGCCCTGGCACTTTTA
CCTCAAGAACCTAGCCCTCAACTTCAACATGTGGTTCGCCCTGGCTCTACTGGCGCTGCCCATCTTCCTCCTCCA
AAAAGCCTTCTCGTCGTCCGGCCACGGCTTCCAATCCGGGTTGCGCACCGTCGTCTTCATCGCCCCCTTTTACAT
GTGGCTCGCCATCTTCACGGCCCAGCCGCACAAGGAAGAGCGATTCATGTACCCGCTCTACCCCTTCCTCGCCCT
CAACGCGTCCATATCCCTGCACATGATTCTATCTGCCTTGGGTCGCGCAGGCTCAAGGACGCTGATAGGCAGGAT
CCCCGGACGACTCAAACTCCTCGGCGCGGGTCTCGTCCTACTTTCATCACTGATTCTCGGACTATCGCGCATCTA
CGGCGTCTACTCAGCCTACAGTGCCCCCTTACGCATCTACCAACCCCTATGGGGCGACTTCAAAGGCAACAACGC
GACCGGCAACCCCGAAGACCCAGTCTGCTTCGGCAAAGACTGGTACCGCTTCCCAACATCCTACTTCCTCCCCCG
CGGCATGCACGCCAAGTTCATCCGCTCCGACTTCCACGGCCTCCTCCCCGGCGAGTTCTCCCAAGCAAAGACCGG
CTTCGGCCTCTGGAGCGGCACCTGGCTCCCCACCCGCGGCCTCAACAACGCCAACAAAGAAGACGCAACCACCTA
CGTCGACGTCCGCGCCTGCGCCCTCCTCGTCGACACGCAGTACCCAGACCGCGCCCACCCACCACCGCCCTCGCC
CAACGAGCCCGACTACGCCGCTGACGCGGGCACGTGGGCCGTCGTCAGGTGCGAGCCCTTTCTCGACGCGGCGGC
CACGCACCTCGTCGCCCGCGCGCTTTGGGTGCCGGACCTGGCGATTGTGCCGCAGAGGTTGAGGAGGAAATGGGG
GCGGCACTGTCTGCTGCAGAGGCGGAGGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail