Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1817
Gene name
LocationContig_18:52060..53451
Strand-
Gene length (bp)1391
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 9.2E-13 62 331

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 55 409 4.0E-40
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 45 395 9.0E-30
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 2 395 9.0E-27
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 46 395 2.0E-21
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 23 335 2.0E-16

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1817
MLMLSRLLVWSLSLSCLAYEANASPPRSTSRVAAHRFVNDSRATRPLMFNADGKFKLSIFEDLHLGENSWNSWGH
QQDINTVGVIERTVDAEKPDLVVFNGDLITGENAFRENSTAVIDMMVAPLLQRSLPWASTYGNHDNQVNLSSADI
FAHEKRWPNARAQNMVSDRNAGVTNYYLPVYGPNCSEPQCVPELLLWFFDSRGGGEYQKSMDDLSEHPRAPWVDK
SVVDWYQKTRANLRKRHGKELPSLAFVHIPIRASYAVAMEHGRNSIDPHHHPGINDDWPLSAQGQGWCPDGRRDA
ACAYGGQDVPFMKAIVETPGLIGLFSGHDHGNSWCYHWDHLVPGMTVAGKGLNLCFGQRSGYAGYGQWERGSRQV
RLSRDRLRNGPEAETWIRLDSGGFVSSVVLNSTYGKDWYPKTPNTKSFCPTCDYSVITKRPYKRAVVSV*
Coding >Ophun1|1817
ATGCTCATGTTGTCAAGGCTGCTTGTCTGGTCCCTGTCGCTCTCGTGCCTGGCCTACGAAGCCAATGCCTCGCCT
CCGCGGTCCACATCGCGGGTGGCGGCGCATCGATTCGTCAACGATAGTCGAGCGACGAGGCCGCTGATGTTCAAC
GCCGATGGCAAGTTTAAGCTATCTATATTTGAGGATCTTCACCTTGGTGAGAATTCTTGGAACTCCTGGGGTCAT
CAGCAGGATATCAACACAGTTGGCGTCATCGAGAGAACGGTGGACGCCGAGAAACCAGACCTGGTTGTCTTCAAC
GGCGATCTCATAACTGGCGAGAATGCGTTTCGAGAGAACAGCACAGCCGTCATCGATATGATGGTAGCGCCCCTA
CTCCAGCGCAGTCTTCCTTGGGCATCGACGTACGGAAACCACGATAACCAAGTCAACCTCTCGTCGGCCGACATC
TTTGCTCACGAGAAGCGCTGGCCCAATGCCCGGGCGCAGAACATGGTGTCAGACCGCAATGCCGGGGTAACCAAC
TACTATCTCCCCGTATATGGCCCCAATTGCAGCGAGCCTCAGTGCGTGCCGGAGCTGCTTTTGTGGTTCTTTGAT
AGCCGGGGCGGCGGCGAATACCAGAAGAGCATGGATGACTTGTCTGAACACCCTCGCGCCCCATGGGTAGACAAG
AGTGTCGTCGACTGGTATCAGAAGACTCGGGCGAACCTCCGAAAGCGTCATGGCAAGGAGCTACCGTCTCTGGCT
TTTGTTCACATCCCTATCCGGGCTTCATATGCGGTGGCAATGGAGCACGGGCGGAACAGCATAGATCCTCACCAC
CACCCGGGCATCAACGACGACTGGCCGCTATCCGCTCAAGGCCAAGGCTGGTGTCCGGACGGACGCCGCGATGCC
GCATGCGCATACGGCGGCCAAGACGTGCCATTCATGAAGGCAATAGTGGAAACGCCGGGGCTCATCGGCCTCTTC
TCCGGCCACGACCACGGAAACTCTTGGTGTTATCACTGGGATCACCTGGTTCCCGGCATGACGGTAGCCGGCAAA
GGCCTCAACCTCTGCTTCGGCCAACGGTCTGGCTACGCCGGCTATGGTCAGTGGGAGCGCGGCAGCCGACAGGTA
CGGCTTTCCCGCGACCGGCTCCGCAACGGCCCAGAGGCCGAGACATGGATCCGGCTCGACTCGGGCGGCTTTGTG
AGCAGCGTCGTTCTCAACTCGACCTACGGAAAGGACTGGTATCCTAAGACGCCCAACACAAAGAGCTTCTGTCCC
ACGTGCGACTATAGCGTTATCACCAAGCGGCCATACAAGAGGGCGGTTGTGTCTGTTTAG
Transcript >Ophun1|1817
ATGCTCATGTTGTCAAGGCTGCTTGTCTGGTCCCTGTCGCTCTCGTGCCTGGCCTACGAAGCCAATGCCTCGCCT
CCGCGGTCCACATCGCGGGTGGCGGCGCATCGATTCGTCAACGATAGTCGAGCGACGAGGCCGCTGATGTTCAAC
GCCGATGGCAAGTTTAAGCTATCTATATTTGAGGATCTTCACCTTGGTGAGAATTCTTGGAACTCCTGGGGTCAT
CAGCAGGATATCAACACAGTTGGCGTCATCGAGAGAACGGTGGACGCCGAGAAACCAGACCTGGTTGTCTTCAAC
GGCGATCTCATAACTGGCGAGAATGCGTTTCGAGAGAACAGCACAGCCGTCATCGATATGATGGTAGCGCCCCTA
CTCCAGCGCAGTCTTCCTTGGGCATCGACGTACGGAAACCACGATAACCAAGTCAACCTCTCGTCGGCCGACATC
TTTGCTCACGAGAAGCGCTGGCCCAATGCCCGGGCGCAGAACATGGTGTCAGACCGCAATGCCGGGGTAACCAAC
TACTATCTCCCCGTATATGGCCCCAATTGCAGCGAGCCTCAGTGCGTGCCGGAGCTGCTTTTGTGGTTCTTTGAT
AGCCGGGGCGGCGGCGAATACCAGAAGAGCATGGATGACTTGTCTGAACACCCTCGCGCCCCATGGGTAGACAAG
AGTGTCGTCGACTGGTATCAGAAGACTCGGGCGAACCTCCGAAAGCGTCATGGCAAGGAGCTACCGTCTCTGGCT
TTTGTTCACATCCCTATCCGGGCTTCATATGCGGTGGCAATGGAGCACGGGCGGAACAGCATAGATCCTCACCAC
CACCCGGGCATCAACGACGACTGGCCGCTATCCGCTCAAGGCCAAGGCTGGTGTCCGGACGGACGCCGCGATGCC
GCATGCGCATACGGCGGCCAAGACGTGCCATTCATGAAGGCAATAGTGGAAACGCCGGGGCTCATCGGCCTCTTC
TCCGGCCACGACCACGGAAACTCTTGGTGTTATCACTGGGATCACCTGGTTCCCGGCATGACGGTAGCCGGCAAA
GGCCTCAACCTCTGCTTCGGCCAACGGTCTGGCTACGCCGGCTATGGTCAGTGGGAGCGCGGCAGCCGACAGGTA
CGGCTTTCCCGCGACCGGCTCCGCAACGGCCCAGAGGCCGAGACATGGATCCGGCTCGACTCGGGCGGCTTTGTG
AGCAGCGTCGTTCTCAACTCGACCTACGGAAAGGACTGGTATCCTAAGACGCCCAACACAAAGAGCTTCTGTCCC
ACGTGCGACTATAGCGTTATCACCAAGCGGCCATACAAGAGGGCGGTTGTGTCTGTTTAG
Gene >Ophun1|1817
ATGCTCATGTTGTCAAGGCTGCTTGTCTGGTCCCTGTCGCTCTCGTGCCTGGCCTACGAAGCCAATGCCTCGCCT
CCGCGGTCCACATCGCGGGTGGCGGCGCATCGATTCGTCAACGATAGTCGAGCGACGAGGCCGCTGATGTTCAAC
GCCGATGGCAAGTTTAAGCTATCTATATTTGAGGATCTTCACCTTGGTGAGAGTAAGTCTCAGCCATCAGACGCT
CGCGCCGCCAAAGAAGACGAGTAACCTATTCAGATTCTTGGAACTCCTGGGGTCATCAGCAGGATATCAACACAG
TTGGCGTCATCGAGAGAACGGTGGACGCCGAGAAACCAGACCTGGTTGTCTTCAACGGCGATCTCATAACTGGCG
AGAATGCGTTTCGAGAGAACAGCACAGCCGTCATCGATATGATGGTAGCGCCCCTACTCCAGCGCAGTCTTCCTT
GGGCATCGACGTACGGAAACCACGATAACCAAGTCAACCTCTCGTCGGCCGACATCTTTGCTCACGAGAAGCGCT
GGCCCAATGCCCGGGCGCAGAACATGGTGTCAGACCGCAATGCCGGGGTAACCAACTACTATCTCCCCGTATATG
GCCCCAATTGCAGCGAGCCTCAGTGCGTGCCGGAGCTGCTTTTGTGGTTCTTTGATAGCCGGGGCGGCGGCGAAT
ACCAGAAGAGCATGGATGACTTGTCTGAACACCCTCGCGCCCCATGGGTAGACAAGAGTGTCGTCGACTGGTATC
AGAAGACTCGGGCGAACCTCCGAAAGCGTCATGGCAAGGAGCTACCGTCTCTGGCTTTTGTTCACATCCCTATCC
GGGCTTCATATGCGGTGGCAATGGAGCACGGGCGGAACAGCATAGATCCTCACCACCACCCGGGCATCAACGACG
ACTGGCCGCTATCCGCTCAAGGCCAAGGCTGGTGTCCGGACGGACGCCGCGATGCCGCATGCGCATACGGCGGCC
AAGACGTGCCATTCATGAAGGCAATAGTGGAAACGCCGGGGCTCATCGGCCTCTTCTCCGGCCACGACCACGGAA
ACTCTTGGTGTTATCACTGGGATCACCTGGTTCCCGGCATGACGGTAGCCGGCAAAGGCCTCAACCTCTGCTTCG
GCCAACGGTCTGGCTACGCCGGCTATGGTCAGTGGGAGCGCGGCAGCCGACAGGTACGGCTTTCCCGCGACCGGC
TCCGCAACGGCCCAGAGGCCGAGACATGGATCCGGCTCGACTCGGGCGGCTTTGTGAGCAGCGTCGTTCTCAACT
CGACCTACGGAAAGGACTGGTATCCTAAGACGCCCAACACAAAGAGCTTCTGTCCCACGTGCGACTATAGCGTTA
TCACCAAGCGGCCATACAAGAGGGCGGTTGTGTCTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail