Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1815
Gene name
LocationContig_18:36144..41375
Strand-
Gene length (bp)5231
Transcript length (bp)4410
Coding sequence length (bp)4410
Protein length (aa) 1470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.0E-51 508 875
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-08 998 1045

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 522 1022 2.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 507 1060 4.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 537 1063 4.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 496 1063 5.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 520 1058 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 522 1022 2.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 507 1060 4.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 537 1063 4.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 496 1063 5.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 520 1058 3.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 503 1063 4.0E-53
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 522 1045 7.0E-53
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 511 1045 4.0E-52
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 496 1080 1.0E-51
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 483 1042 2.0E-51
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 496 1054 4.0E-51
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 496 1054 6.0E-51
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 542 1045 2.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 564 1046 4.0E-50
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 483 1058 6.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 496 1055 7.0E-50
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 501 1044 8.0E-50
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 520 1055 4.0E-49
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 496 1045 8.0E-49
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 383 1053 9.0E-49
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 496 1045 3.0E-48
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 496 1045 4.0E-47
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 496 1049 2.0E-46
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 510 1048 2.0E-46
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 530 1048 3.0E-46
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 512 1045 4.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 510 1048 4.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 504 1046 7.0E-46
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 504 1046 9.0E-46
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 494 1045 1.0E-45
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 542 1060 1.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 512 1052 1.0E-45
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 542 1045 2.0E-45
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 493 1045 3.0E-45
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 496 1042 5.0E-45
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 542 1046 7.0E-45
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 493 1049 7.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 514 1062 9.0E-45
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 494 1046 1.0E-44
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 542 1045 1.0E-44
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 545 1055 4.0E-44
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 536 1046 1.0E-43
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 496 1055 2.0E-43
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 476 1045 2.0E-43
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 521 1043 3.0E-43
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 476 1045 5.0E-43
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 476 1046 7.0E-43
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 479 1045 1.0E-42
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 437 1045 1.0E-42
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 530 1055 2.0E-42
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 539 1046 9.0E-42
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 537 1044 9.0E-42
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 494 1045 1.0E-41
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 542 1048 1.0E-41
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 520 1048 1.0E-41
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 510 1053 1.0E-41
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 491 1044 5.0E-41
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 496 1047 6.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 520 1055 7.0E-41
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 492 1045 7.0E-41
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 494 1062 9.0E-41
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 536 1049 1.0E-39
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 496 1059 2.0E-39
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 523 1045 2.0E-39
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 537 1048 3.0E-39
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 537 1047 3.0E-39
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 439 1045 9.0E-39
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 511 1046 4.0E-38
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 511 1046 4.0E-38
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 526 1055 7.0E-38
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 510 1062 1.0E-37
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 510 1062 1.0E-37
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 483 1048 4.0E-37
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 508 1063 5.0E-37
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 536 1044 2.0E-36
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 517 917 3.0E-36
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 530 1038 9.0E-36
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 520 1048 2.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 522 1057 2.0E-35
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 564 1049 2.0E-35
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 496 1042 2.0E-35
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 494 1045 1.0E-34
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 549 1048 1.0E-34
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 549 1048 2.0E-34
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 549 1048 2.0E-34
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 542 1046 3.0E-34
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 513 1038 8.0E-34
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 536 1042 1.0E-33
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 491 1054 1.0E-33
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 549 1023 2.0E-33
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 556 1042 2.0E-33
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 497 1051 2.0E-32
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 522 1045 3.0E-32
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 532 1057 3.0E-32
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 502 1064 3.0E-32
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 569 1048 4.0E-32
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 497 1051 4.0E-32
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 537 1045 8.0E-32
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 501 1045 1.0E-31
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 537 1045 1.0E-31
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 511 1037 2.0E-31
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 511 1037 2.0E-31
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 564 1045 2.0E-31
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 497 1051 2.0E-31
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 494 1081 3.0E-31
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 537 899 3.0E-31
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 544 1045 4.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 498 961 4.0E-31
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 486 1053 6.0E-31
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 537 1042 1.0E-30
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 567 1045 2.0E-30
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 537 1045 2.0E-30
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 496 1035 3.0E-30
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 495 1052 3.0E-30
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 495 1052 8.0E-30
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 497 928 2.0E-29
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 569 1051 4.0E-29
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 1 480 1.0E-28
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 536 1060 2.0E-28
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 567 974 2.0E-28
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 567 961 2.0E-28
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 518 885 3.0E-28
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 535 1047 1.0E-27
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 509 889 1.0E-27
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 566 961 1.0E-27
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 567 961 1.0E-27
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 496 1045 2.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 562 976 2.0E-27
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 495 1038 2.0E-27
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 527 1058 4.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 542 921 6.0E-27
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 567 961 8.0E-27
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 566 961 9.0E-27
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 566 961 9.0E-27
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 566 961 9.0E-27
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 566 961 1.0E-26
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 566 961 2.0E-26
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 536 965 3.0E-26
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 566 961 3.0E-26
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 632 1144 4.0E-26
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 566 961 4.0E-26
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 566 961 4.0E-26
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 566 961 5.0E-26
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 566 961 6.0E-26
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 566 961 6.0E-26
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 566 961 6.0E-26
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 566 961 6.0E-26
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 505 1061 8.0E-26
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 567 961 8.0E-26
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 570 1047 9.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 539 1032 9.0E-26
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 566 961 9.0E-26
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 566 961 9.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 568 961 1.0E-25
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 542 1045 2.0E-25
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 572 961 4.0E-25
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 498 958 2.0E-24
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 567 961 4.0E-24
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 553 1051 1.0E-23
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 542 917 1.0E-23
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 564 961 3.0E-23
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 564 961 3.0E-23
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 569 1044 8.0E-23
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 569 1066 2.0E-22
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 569 962 2.0E-22
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 498 958 3.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 574 917 3.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 551 1047 4.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 500 961 6.0E-22
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 569 1062 8.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 540 906 1.0E-21
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 478 1052 3.0E-21
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 631 981 6.0E-21
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 542 1060 9.0E-21
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 569 1023 1.0E-20
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 564 961 1.0E-20
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 564 961 1.0E-20
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 564 961 1.0E-20
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 564 961 1.0E-20
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 564 961 1.0E-20
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 564 961 1.0E-20
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 564 961 1.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 567 889 2.0E-20
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 564 961 2.0E-20
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 564 961 2.0E-20
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 564 961 2.0E-20
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 564 961 2.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 564 1016 5.0E-20
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 569 961 1.0E-19
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 500 1045 1.0E-19
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 631 961 2.0E-19
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 495 917 5.0E-19
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 569 1042 1.0E-18
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 626 1042 1.0E-18
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 569 1042 1.0E-18
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 626 1042 1.0E-18
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 567 967 2.0E-18
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 567 967 3.0E-18
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 542 920 1.0E-17
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 524 967 2.0E-17
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 524 967 2.0E-17
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 570 920 2.0E-17
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 524 967 3.0E-17
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 542 1044 6.0E-17
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 550 961 7.0E-17
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 550 961 7.0E-17
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 550 961 7.0E-17
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 550 961 7.0E-17
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 550 961 1.0E-16
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 550 961 1.0E-16
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 567 967 1.0E-16
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 550 961 2.0E-16
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 567 967 2.0E-16
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 567 967 3.0E-16
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 567 967 3.0E-16
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 567 967 3.0E-16
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 567 967 3.0E-16
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 567 967 3.0E-16
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 567 967 3.0E-16
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 510 900 2.0E-15
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 567 958 5.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 569 902 9.0E-15
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 567 958 1.0E-14
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 569 1042 4.0E-14
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 629 961 2.0E-13
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 628 961 4.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 629 961 1.0E-12
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 543 961 2.0E-12
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 591 966 2.0E-12
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 604 1054 1.0E-11
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 494 961 1.0E-11
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 848 1045 1.0E-11
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 538 970 4.0E-11
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 635 1046 9.0E-11
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 542 1046 1.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 631 961 3.0E-10
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 607 893 1.0E-09
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 635 1011 1.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 848 1046 2.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 542 874 4.0E-09
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 629 969 4.0E-09
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 628 961 5.0E-09
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 624 961 5.0E-09
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 542 961 6.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 633 972 8.0E-09
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 632 920 1.0E-08
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 493 969 2.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 633 972 2.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 629 920 3.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 633 972 5.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 620 899 5.0E-08
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 631 961 1.0E-07
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 516 917 2.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 492 961 3.0E-07
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 631 991 5.0E-07
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 631 991 5.0E-07
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 631 991 5.0E-07
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 623 917 6.0E-07
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 631 889 3.0E-06
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 511 929 4.0E-06
sp|Q7ZVE6|KDEL1_DANRE KDEL motif-containing protein 1 OS=Danio rerio GN=kdelc1 PE=2 SV=1 377 499 5.0E-06
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 632 961 5.0E-06
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 632 961 5.0E-06
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 632 961 5.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 633 961 6.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 927 1042 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 1065 1087 22
2 1231 1253 22
3 1263 1285 22
4 1428 1450 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1815
MKEAKSRFRTQLNTRSFTVEQAAARYRERRGRHPPPGFDKWFEQAKKDDAVIVEDFFDRIHHDINPFWALKPADL
RNRTSHQPQVIRIRKGKTWFVTDDPDREPWIQLWTALVKEMMPHIPDLDMVINFMDESRVLVPWEKISEYVKTEQ
SQRKLISPEKAISTYSGLNDAGSEKEKPYDPGWITEDAPKYWEYLRKACPPRSPGRKAAALKSFNVSIDYPRKPL
PYMMEGFVKNFTQAQDPCLQPHLRGMHGTFIESVSISTTLELFPMFGGSKLPQNNELLIPGAMYLSDRAFYSGGA
GHGPPWGDKSGAMVWRGTASGGRNKKDNWWHFHRHRWVQMLNGTTVAAVGSGDSTRGPTFKIPGDSQLPEPIEDS
QRLSQWISSVADVAFVNLECFPSEETEIWPLKSHLPMKKQYDYKLLPDVDGNSFSGRWRAFLQSTSLPLKSTIYT
EWHDDRIVPWLHFVPFDNSYMDIYAIMHFFLEEDEEAAKEIAGEARTLLDILNETTASHHQAAALDDGIECLSYS
ALAARVTTRAARVTTRAARLRALGVGVGDRVGVRVRSGTAELYVSVLSVLACGAAYVPVDADDPDGRAEMVWAEA
GVCIVLSTDETVTKLREPKGKQRWPTIRDDAWIIFTSGSTGKPKGVAVTHLSAAAFIHAEAQSLTAILPSDRVLA
SLSVSFDASCEEMWLAWRNGACLVPASRALVRAGAELGLFLASRVISVVSTVPTLAALWPDEALRRVRLLILGGE
ACSSPLVTRLAGPGRCVWKTDGPTEATVVSSVARLEVGEPVRIGLPLPGWTLAVVGPDGQPVQWGQPGELIIGGA
GIARYLDAELDSKRMAPALGWKRAYRTGDIVRVDRAGLVFLGRGDDQVKLAGRRVEQGEIDAALADLLGVRAAAC
AVRSSETGDDLLIGYIVREDEPTSADREILLLRLSGALVSLLARVDGIPMKTSGKADRAALPLTLPGSERRSRNL
SLSGTEGWLAEQRRLVLGNEPAGSEDDLFELGATSLSVVQLISLLRRRCPTLSVKDLYSHPTLGDMAALIDGQVE
TKHAARVMKPMPRFTGFIQVFVIIGILTLEGLRWLVILMTIAKVTSLVQNNHDLWITPLPSWWQLVPAWMLLISI
PGRVLVTAFTARLLTASLRPGRYPRGGAIHLGLWAAERLVETSAVSAVTGTHWCRRYARLLECRVGEDAQLHSGI
VSGATEVVPELGSGREDAETQLPYDISLAAVEALQGAVVAAPALIIFPVLLALDSPGRQAVLMLALSIPATAASV
LGYAGLVAVLIRFASRHLQKVGRGVEASTVVTIPSLLEVGDGAFLADDVLLAPYRLAAGRLHIGSVEISTRALVG
NWAMVDSDNPVPDGALIGVLATAPPAAEAAASGPGSAWLGRPAIPLPYRLEPGERSQTHDPPIRLVLARAFIESW
RLLPLVLSALLADAVAAIVIWLVDVIGILGAAASEGILPFGGYS*
Coding >Ophun1|1815
ATGAAGGAGGCCAAGTCGCGATTCCGAACACAACTCAACACTCGCTCCTTCACCGTCGAGCAAGCCGCAGCTCGC
TACCGAGAACGTCGAGGCCGCCACCCTCCGCCCGGATTCGACAAGTGGTTCGAGCAGGCGAAAAAGGACGATGCT
GTCATTGTCGAGGACTTCTTCGATCGCATACACCACGACATCAATCCCTTCTGGGCCTTGAAGCCTGCAGACCTG
CGGAACCGAACCAGCCACCAGCCGCAAGTGATTCGAATCCGAAAGGGAAAGACTTGGTTCGTGACGGATGACCCG
GATCGGGAGCCATGGATTCAACTATGGACTGCGCTCGTGAAGGAGATGATGCCTCATATTCCGGACCTTGACATG
GTCATCAATTTCATGGACGAATCTCGCGTGCTCGTGCCGTGGGAAAAGATATCAGAATACGTCAAGACCGAGCAG
AGCCAGAGAAAGCTGATCAGCCCTGAAAAGGCGATTTCTACTTACAGCGGGCTCAATGACGCTGGCAGCGAAAAA
GAAAAGCCCTATGACCCTGGCTGGATCACCGAAGACGCACCAAAATACTGGGAGTACTTGCGCAAAGCCTGTCCT
CCCCGAAGCCCAGGACGAAAAGCCGCCGCTCTCAAGTCTTTCAACGTCTCCATCGACTATCCCCGCAAGCCTCTG
CCATACATGATGGAAGGCTTCGTCAAGAACTTTACCCAGGCTCAGGACCCCTGTCTGCAGCCTCACTTGCGGGGC
ATGCACGGCACCTTCATCGAAAGCGTCAGCATATCCACAACGTTGGAACTGTTTCCCATGTTTGGAGGCTCGAAG
CTACCGCAGAACAATGAACTTCTCATCCCTGGGGCCATGTATCTCTCAGACCGCGCTTTCTACAGCGGTGGAGCA
GGACATGGACCGCCCTGGGGGGATAAATCTGGTGCCATGGTCTGGAGAGGGACTGCGTCTGGCGGCCGCAATAAA
AAAGATAACTGGTGGCACTTCCACAGACACAGATGGGTGCAGATGTTGAACGGGACGACCGTCGCCGCAGTGGGA
AGCGGCGACAGCACTCGAGGTCCGACCTTTAAGATTCCAGGAGACAGCCAGCTTCCTGAGCCGATTGAAGATTCG
CAACGCCTTAGTCAATGGATATCGTCTGTCGCAGACGTGGCCTTTGTCAACCTGGAGTGCTTCCCTTCTGAGGAG
ACCGAAATCTGGCCGCTCAAGAGTCACCTGCCGATGAAGAAGCAGTACGATTACAAGCTTCTCCCAGACGTCGAC
GGGAATTCCTTCAGCGGCAGGTGGAGGGCGTTTCTTCAGTCTACCAGCCTACCACTCAAATCGACCATCTACACC
GAGTGGCATGACGATAGGATAGTGCCGTGGCTACATTTTGTCCCGTTCGACAACTCGTACATGGATATATACGCC
ATTATGCACTTCTTCTTGGAGGAAGATGAAGAAGCCGCCAAAGAAATCGCTGGAGAAGCCCGCACCCTCCTCGAC
ATCCTCAACGAAACCACAGCATCACACCACCAAGCCGCAGCTCTAGACGACGGCATAGAATGCCTCAGCTACAGC
GCCCTCGCCGCCCGGGTCACCACCCGCGCCGCCCGGGTCACCACCCGCGCCGCACGCCTACGAGCCCTTGGCGTA
GGCGTGGGCGACCGCGTGGGCGTACGGGTCCGGTCCGGAACGGCGGAGCTGTACGTTTCCGTGTTGTCGGTGTTG
GCCTGCGGTGCTGCATACGTCCCTGTCGACGCGGATGATCCGGACGGACGGGCTGAGATGGTCTGGGCCGAAGCC
GGTGTCTGCATCGTCTTATCAACGGATGAGACGGTGACGAAACTCCGAGAACCAAAGGGAAAGCAGAGATGGCCC
ACCATCAGAGACGACGCCTGGATAATCTTCACCTCCGGCTCTACAGGCAAGCCAAAAGGCGTAGCAGTAACGCAC
CTCAGCGCCGCAGCCTTCATCCACGCCGAAGCCCAATCCCTCACCGCCATCCTCCCCTCAGACCGCGTTTTAGCC
AGCCTCTCCGTCAGCTTCGACGCCTCGTGCGAAGAGATGTGGCTGGCCTGGCGCAACGGCGCATGTCTCGTCCCC
GCGTCTCGAGCCCTCGTCCGCGCCGGCGCCGAGCTGGGCCTCTTTCTCGCATCTCGGGTTATCAGCGTAGTGTCG
ACGGTACCGACGCTGGCGGCGCTGTGGCCTGATGAGGCGCTGCGACGGGTTCGGCTTCTGATTCTTGGTGGTGAG
GCCTGTTCGTCGCCGTTGGTGACGAGGCTTGCTGGACCGGGCCGCTGCGTGTGGAAAACTGACGGACCGACAGAA
GCAACCGTCGTGTCGAGTGTGGCCCGTCTCGAGGTCGGCGAACCGGTCCGAATCGGCCTTCCGCTCCCCGGCTGG
ACGCTAGCCGTTGTGGGGCCGGACGGACAGCCGGTACAGTGGGGCCAACCGGGCGAGCTGATCATCGGCGGCGCG
GGAATAGCCCGGTATTTGGACGCGGAGCTGGACAGCAAGCGAATGGCACCGGCCCTCGGCTGGAAGCGAGCTTAC
CGCACCGGAGATATAGTCCGAGTCGACCGCGCCGGGCTCGTCTTCCTCGGCCGCGGAGACGATCAGGTTAAGCTG
GCTGGTCGGAGGGTTGAACAGGGTGAGATTGACGCTGCGCTGGCTGACTTGCTGGGCGTAAGGGCGGCGGCTTGT
GCGGTTCGAAGCAGTGAGACTGGCGATGATTTGCTCATCGGCTATATCGTGCGTGAGGATGAGCCGACCTCTGCT
GATCGAGAGATCCTACTACTGCGTCTTTCCGGCGCACTGGTATCGCTCCTCGCTCGCGTCGACGGCATTCCTATG
AAGACATCCGGGAAAGCAGACCGTGCCGCGCTGCCATTAACATTGCCCGGAAGCGAGCGTCGGTCCCGGAACTTG
TCTCTGTCCGGCACGGAAGGCTGGCTCGCTGAGCAGCGGCGTCTAGTGCTTGGAAACGAGCCGGCCGGGTCTGAA
GATGATCTCTTTGAGCTGGGAGCTACGAGCTTGTCGGTTGTGCAGCTCATTTCGCTCCTTCGCCGGCGGTGTCCT
ACGCTCTCTGTCAAGGATCTATATAGTCATCCGACGTTAGGAGACATGGCTGCCTTGATAGACGGACAGGTGGAG
ACAAAGCACGCGGCTCGAGTTATGAAGCCGATGCCGCGCTTCACCGGCTTCATTCAAGTTTTCGTCATCATCGGT
ATACTAACACTGGAGGGTCTACGCTGGCTCGTCATCCTTATGACTATAGCAAAAGTCACGTCCCTCGTTCAGAAC
AATCACGACTTGTGGATAACTCCGCTACCATCCTGGTGGCAGCTCGTCCCAGCCTGGATGCTCCTCATCAGCATC
CCCGGCCGCGTGCTCGTCACTGCCTTCACCGCCCGACTCCTCACAGCCAGTCTTCGTCCAGGCCGTTATCCCCGA
GGCGGAGCAATCCACCTCGGCCTATGGGCAGCAGAGCGGCTCGTGGAAACAAGCGCAGTCAGCGCCGTGACCGGA
ACACACTGGTGCCGGCGCTACGCCCGACTCCTGGAATGCCGCGTTGGGGAAGACGCACAGCTTCACTCGGGAATC
GTGTCCGGGGCTACTGAAGTTGTCCCAGAGTTGGGGTCCGGCCGTGAAGACGCTGAGACTCAACTTCCATATGAT
ATCTCGCTGGCTGCTGTTGAGGCTCTGCAGGGCGCTGTCGTGGCTGCTCCCGCACTCATCATCTTCCCCGTCCTG
CTCGCTTTAGATAGTCCGGGACGACAGGCGGTGCTGATGCTGGCCCTTTCCATCCCGGCGACGGCTGCTAGTGTT
CTCGGCTACGCTGGTCTAGTTGCCGTTCTGATCCGCTTTGCCAGCCGCCATCTTCAGAAAGTCGGACGAGGCGTC
GAGGCATCAACCGTTGTCACTATCCCCTCGCTTCTGGAAGTCGGAGACGGAGCCTTTCTCGCCGACGACGTCTTG
CTAGCTCCCTACCGACTGGCAGCGGGAAGACTTCACATCGGCAGCGTGGAGATTAGCACGCGCGCCTTAGTGGGA
AACTGGGCAATGGTCGACTCGGACAATCCAGTTCCAGACGGCGCTCTGATCGGCGTACTGGCTACCGCACCGCCC
GCCGCCGAAGCCGCTGCCTCCGGTCCGGGCTCGGCTTGGCTCGGCCGGCCGGCAATCCCGCTTCCGTACCGGCTC
GAACCTGGCGAGCGGAGCCAAACTCACGATCCGCCGATTCGTCTTGTGCTTGCTCGCGCTTTTATCGAGTCATGG
CGTTTGCTTCCGCTTGTTCTGTCTGCGCTGCTGGCCGACGCTGTAGCAGCCATCGTGATCTGGTTAGTGGATGTC
ATCGGAATCTTGGGAGCCGCAGCATCTGAAGGCATCTTGCCCTTTGGCGGCTACTCGTAG
Transcript >Ophun1|1815
ATGAAGGAGGCCAAGTCGCGATTCCGAACACAACTCAACACTCGCTCCTTCACCGTCGAGCAAGCCGCAGCTCGC
TACCGAGAACGTCGAGGCCGCCACCCTCCGCCCGGATTCGACAAGTGGTTCGAGCAGGCGAAAAAGGACGATGCT
GTCATTGTCGAGGACTTCTTCGATCGCATACACCACGACATCAATCCCTTCTGGGCCTTGAAGCCTGCAGACCTG
CGGAACCGAACCAGCCACCAGCCGCAAGTGATTCGAATCCGAAAGGGAAAGACTTGGTTCGTGACGGATGACCCG
GATCGGGAGCCATGGATTCAACTATGGACTGCGCTCGTGAAGGAGATGATGCCTCATATTCCGGACCTTGACATG
GTCATCAATTTCATGGACGAATCTCGCGTGCTCGTGCCGTGGGAAAAGATATCAGAATACGTCAAGACCGAGCAG
AGCCAGAGAAAGCTGATCAGCCCTGAAAAGGCGATTTCTACTTACAGCGGGCTCAATGACGCTGGCAGCGAAAAA
GAAAAGCCCTATGACCCTGGCTGGATCACCGAAGACGCACCAAAATACTGGGAGTACTTGCGCAAAGCCTGTCCT
CCCCGAAGCCCAGGACGAAAAGCCGCCGCTCTCAAGTCTTTCAACGTCTCCATCGACTATCCCCGCAAGCCTCTG
CCATACATGATGGAAGGCTTCGTCAAGAACTTTACCCAGGCTCAGGACCCCTGTCTGCAGCCTCACTTGCGGGGC
ATGCACGGCACCTTCATCGAAAGCGTCAGCATATCCACAACGTTGGAACTGTTTCCCATGTTTGGAGGCTCGAAG
CTACCGCAGAACAATGAACTTCTCATCCCTGGGGCCATGTATCTCTCAGACCGCGCTTTCTACAGCGGTGGAGCA
GGACATGGACCGCCCTGGGGGGATAAATCTGGTGCCATGGTCTGGAGAGGGACTGCGTCTGGCGGCCGCAATAAA
AAAGATAACTGGTGGCACTTCCACAGACACAGATGGGTGCAGATGTTGAACGGGACGACCGTCGCCGCAGTGGGA
AGCGGCGACAGCACTCGAGGTCCGACCTTTAAGATTCCAGGAGACAGCCAGCTTCCTGAGCCGATTGAAGATTCG
CAACGCCTTAGTCAATGGATATCGTCTGTCGCAGACGTGGCCTTTGTCAACCTGGAGTGCTTCCCTTCTGAGGAG
ACCGAAATCTGGCCGCTCAAGAGTCACCTGCCGATGAAGAAGCAGTACGATTACAAGCTTCTCCCAGACGTCGAC
GGGAATTCCTTCAGCGGCAGGTGGAGGGCGTTTCTTCAGTCTACCAGCCTACCACTCAAATCGACCATCTACACC
GAGTGGCATGACGATAGGATAGTGCCGTGGCTACATTTTGTCCCGTTCGACAACTCGTACATGGATATATACGCC
ATTATGCACTTCTTCTTGGAGGAAGATGAAGAAGCCGCCAAAGAAATCGCTGGAGAAGCCCGCACCCTCCTCGAC
ATCCTCAACGAAACCACAGCATCACACCACCAAGCCGCAGCTCTAGACGACGGCATAGAATGCCTCAGCTACAGC
GCCCTCGCCGCCCGGGTCACCACCCGCGCCGCCCGGGTCACCACCCGCGCCGCACGCCTACGAGCCCTTGGCGTA
GGCGTGGGCGACCGCGTGGGCGTACGGGTCCGGTCCGGAACGGCGGAGCTGTACGTTTCCGTGTTGTCGGTGTTG
GCCTGCGGTGCTGCATACGTCCCTGTCGACGCGGATGATCCGGACGGACGGGCTGAGATGGTCTGGGCCGAAGCC
GGTGTCTGCATCGTCTTATCAACGGATGAGACGGTGACGAAACTCCGAGAACCAAAGGGAAAGCAGAGATGGCCC
ACCATCAGAGACGACGCCTGGATAATCTTCACCTCCGGCTCTACAGGCAAGCCAAAAGGCGTAGCAGTAACGCAC
CTCAGCGCCGCAGCCTTCATCCACGCCGAAGCCCAATCCCTCACCGCCATCCTCCCCTCAGACCGCGTTTTAGCC
AGCCTCTCCGTCAGCTTCGACGCCTCGTGCGAAGAGATGTGGCTGGCCTGGCGCAACGGCGCATGTCTCGTCCCC
GCGTCTCGAGCCCTCGTCCGCGCCGGCGCCGAGCTGGGCCTCTTTCTCGCATCTCGGGTTATCAGCGTAGTGTCG
ACGGTACCGACGCTGGCGGCGCTGTGGCCTGATGAGGCGCTGCGACGGGTTCGGCTTCTGATTCTTGGTGGTGAG
GCCTGTTCGTCGCCGTTGGTGACGAGGCTTGCTGGACCGGGCCGCTGCGTGTGGAAAACTGACGGACCGACAGAA
GCAACCGTCGTGTCGAGTGTGGCCCGTCTCGAGGTCGGCGAACCGGTCCGAATCGGCCTTCCGCTCCCCGGCTGG
ACGCTAGCCGTTGTGGGGCCGGACGGACAGCCGGTACAGTGGGGCCAACCGGGCGAGCTGATCATCGGCGGCGCG
GGAATAGCCCGGTATTTGGACGCGGAGCTGGACAGCAAGCGAATGGCACCGGCCCTCGGCTGGAAGCGAGCTTAC
CGCACCGGAGATATAGTCCGAGTCGACCGCGCCGGGCTCGTCTTCCTCGGCCGCGGAGACGATCAGGTTAAGCTG
GCTGGTCGGAGGGTTGAACAGGGTGAGATTGACGCTGCGCTGGCTGACTTGCTGGGCGTAAGGGCGGCGGCTTGT
GCGGTTCGAAGCAGTGAGACTGGCGATGATTTGCTCATCGGCTATATCGTGCGTGAGGATGAGCCGACCTCTGCT
GATCGAGAGATCCTACTACTGCGTCTTTCCGGCGCACTGGTATCGCTCCTCGCTCGCGTCGACGGCATTCCTATG
AAGACATCCGGGAAAGCAGACCGTGCCGCGCTGCCATTAACATTGCCCGGAAGCGAGCGTCGGTCCCGGAACTTG
TCTCTGTCCGGCACGGAAGGCTGGCTCGCTGAGCAGCGGCGTCTAGTGCTTGGAAACGAGCCGGCCGGGTCTGAA
GATGATCTCTTTGAGCTGGGAGCTACGAGCTTGTCGGTTGTGCAGCTCATTTCGCTCCTTCGCCGGCGGTGTCCT
ACGCTCTCTGTCAAGGATCTATATAGTCATCCGACGTTAGGAGACATGGCTGCCTTGATAGACGGACAGGTGGAG
ACAAAGCACGCGGCTCGAGTTATGAAGCCGATGCCGCGCTTCACCGGCTTCATTCAAGTTTTCGTCATCATCGGT
ATACTAACACTGGAGGGTCTACGCTGGCTCGTCATCCTTATGACTATAGCAAAAGTCACGTCCCTCGTTCAGAAC
AATCACGACTTGTGGATAACTCCGCTACCATCCTGGTGGCAGCTCGTCCCAGCCTGGATGCTCCTCATCAGCATC
CCCGGCCGCGTGCTCGTCACTGCCTTCACCGCCCGACTCCTCACAGCCAGTCTTCGTCCAGGCCGTTATCCCCGA
GGCGGAGCAATCCACCTCGGCCTATGGGCAGCAGAGCGGCTCGTGGAAACAAGCGCAGTCAGCGCCGTGACCGGA
ACACACTGGTGCCGGCGCTACGCCCGACTCCTGGAATGCCGCGTTGGGGAAGACGCACAGCTTCACTCGGGAATC
GTGTCCGGGGCTACTGAAGTTGTCCCAGAGTTGGGGTCCGGCCGTGAAGACGCTGAGACTCAACTTCCATATGAT
ATCTCGCTGGCTGCTGTTGAGGCTCTGCAGGGCGCTGTCGTGGCTGCTCCCGCACTCATCATCTTCCCCGTCCTG
CTCGCTTTAGATAGTCCGGGACGACAGGCGGTGCTGATGCTGGCCCTTTCCATCCCGGCGACGGCTGCTAGTGTT
CTCGGCTACGCTGGTCTAGTTGCCGTTCTGATCCGCTTTGCCAGCCGCCATCTTCAGAAAGTCGGACGAGGCGTC
GAGGCATCAACCGTTGTCACTATCCCCTCGCTTCTGGAAGTCGGAGACGGAGCCTTTCTCGCCGACGACGTCTTG
CTAGCTCCCTACCGACTGGCAGCGGGAAGACTTCACATCGGCAGCGTGGAGATTAGCACGCGCGCCTTAGTGGGA
AACTGGGCAATGGTCGACTCGGACAATCCAGTTCCAGACGGCGCTCTGATCGGCGTACTGGCTACCGCACCGCCC
GCCGCCGAAGCCGCTGCCTCCGGTCCGGGCTCGGCTTGGCTCGGCCGGCCGGCAATCCCGCTTCCGTACCGGCTC
GAACCTGGCGAGCGGAGCCAAACTCACGATCCGCCGATTCGTCTTGTGCTTGCTCGCGCTTTTATCGAGTCATGG
CGTTTGCTTCCGCTTGTTCTGTCTGCGCTGCTGGCCGACGCTGTAGCAGCCATCGTGATCTGGTTAGTGGATGTC
ATCGGAATCTTGGGAGCCGCAGCATCTGAAGGCATCTTGCCCTTTGGCGGCTACTCGTAG
Gene >Ophun1|1815
ATGAAGGAGGCCAAGTCGCGATTCCGAACACAACTCAACACTCGCTCCTTCACCGTCGAGCAAGCCGCAGCTCGC
TACCGAGAACGTCGAGGCCGCCACCCTCCGCCCGGATTCGACAAGTGGTTCGAGCAGGCGAAAAAGGACGATGCT
GTCATTGTCGAGGACTTCTTCGATCGCATACACCACGACATCAATCCCTTCTGGGCCTTGAAGCCTGCAGACCTG
CGGAACCGAACCAGCCACCAGCCGCAAGTGATTCGAATCCGAAAGGGAAAGACTTGGTTCGTGACGGATGACCCG
GATCGGGAGCCATGGATTCAACTATGGACTGCGCTCGTGAAGGAGATGATGCCTCATATTCCGGACCTTGACATG
GTCATCAATTTCATGGACGAATCTCGCGTGCTCGTGCCGTGGGAAAAGATATCAGAATACGTCAAGACCGAGCAG
AGCCAGAGAAAGCTGATCAGCCCTGAAAAGGCGATTTCTACTTACAGCGGGCTCAATGACGCTGGCAGCGAAAAA
GAAAAGCCCTATGACCCTGGCTGGATCACCGAAGACGCACCAAAATACTGGGAGTACTTGCGCAAAGCCTGTCCT
CCCCGAAGCCCAGGACGAAAAGCCGCCGCTCTCAAGTCTTTCAACGTCTCCATCGACTATCCCCGCAAGCCTCTG
CCATACATGATGGAAGGCTTCGTCAAGAACTTTACCCAGGCTCAGGACCCCTGTCTGCAGCCTCACTTGCGGGGC
ATGCACGGCACCTTCATCGAAAGCGTCAGCATATCCACAACGTTGGAACTGTTTCCCATGTTTGGAGGCTCGAAG
CTACCGCAGAACAATGAACTTCTCATCCCTGGGGCCATGTATCTCTCAGACCGCGCTTTCTACAGCGGTGGAGCA
GGACATGGACCGCCCTGGGGGGATAAATCTGGTGCCATGGTCTGGAGAGGGACTGCGTCTGGCGGCCGCAATAAA
AAAGATAACTGGTGGCACTTCCACAGACACAGATGGGTGCAGATGTTGAACGGGACGACCGTCGCCGCAGTGGGA
AGCGGCGACAGCACTCGAGGTCCGACCTTTAAGATTCCAGGAGACAGCCAGCTTCCTGAGCCGATTGAAGATTCG
CAACGCCTTAGTCAATGGATATCGTCTGTCGCAGACGTGGCCTTTGTCAACCTGGAGTGCTTCCCTTCTGAGGAG
ACCGAAATCTGGCCGCTCAAGGTCCGCGACAAAAAAAAGACATGTTCATATACCTCGCCCTTCTACTCCTTAAAG
AGTCACCTGCCGATGAAGAAGCAGTACGATTACAAGCTTCTCCCAGACGTCGACGGGAATTCCTTCAGCGGCAGG
TGGAGGGCGTTTCTTCAGTCTACCAGCCTACCACTCAAATCGACCATCTACACCGAGTGGCATGACGATAGGATA
GTGCCGTGGCTACATTTTGTCCCGTTCGACAACTCGTACATGGATATATACGCCATTATGCACTTCTTCTTGGAG
GAAGATGAAGAAGCCGCCAAAGAAATCGCTGGAGAAGGTGCGAAATGGTCGCAGTCAGTATATCGGCGGGAGGAC
ATGAAGCTGTATGTTTGGAGGCTTTTGTTGGAGTATGCTAGGGTTGTAGACGATGAGCGAGATCGCCTCGGTTTT
GTTGACGATTTGTTATGAGCGCTTGTTGTCTACATACATGTAAGAAAAGCACCTATTAATAACAGCTAGAGAAAT
TCATAATAAGCTTGATTTCAGACAGGGATCTACCCTTGCTTCTTTCTGTCTCAGGCTTGCTTATGTCTGAGATGC
AAACAAGGGCAGGGGGGCAATCCAAGTGAGTGACATTCAGCCGCAGGCGTGACGGGACCTTGAAGGAGCCGAACG
ACGGGAAAGGTTACATTGCAAGGATAAAACTCAGATAAGGCTGCAGAGAACCCGTCGGAGTAACGGGCCCTTTTC
TCATCTGGTATGGCGGTTAAGCATAGTCAAGTAGGCCATTATTTTCACCCGTCACGAGTGTCAATATGCGACGAG
GAAATGAGATACGTAACAGCCGAGCGACTGCATCTACGCTGAAAGTCTGAGATGGCAGGCTGCCCAAACAAGGAA
TACAGTGAAACCACGCCCTACAGATCCCCAGACGCAGCAATCTATCAATCCCCCCCCGCGCCACCAGCCCGCACC
CTCCTCGACATCCTCAACGAAACCACAGCATCACACCACCAAGCCGCAGCTCTAGACGACGGCATAGAATGCCTC
AGCTACAGCGCCCTCGCCGCCCGGGTCACCACCCGCGCCGCCCGGGTCACCACCCGCGCCGCACGCCTACGAGCC
CTTGGCGTAGGCGTGGGCGACCGCGTGGGCGTACGGGTCCGGTCCGGAACGGCGGAGCTGTACGTTTCCGTGTTG
TCGGTGTTGGCCTGCGGTGCTGCATACGTCCCTGTCGACGCGGATGATCCGGACGGACGGGCTGAGATGGTCTGG
GCCGAAGCCGGTGTCTGCATCGTCTTATCAACGGATGAGACGGTGACGAAACTCCGAGAACCAAAGGGAAAGCAG
AGATGGCCCACCATCAGAGACGACGCCTGGATAATCTTCACCTCCGGCTCTACAGGCAAGCCAAAAGGCGTAGCA
GTAACGCACCTCAGCGCCGCAGCCTTCATCCACGCCGAAGCCCAATCCCTCACCGCCATCCTCCCCTCAGACCGC
GTTTTAGCCAGCCTCTCCGTCAGCTTCGACGCCTCGTGCGAAGAGATGTGGCTGGCCTGGCGCAACGGCGCATGT
CTCGTCCCCGCGTCTCGAGCCCTCGTCCGCGCCGGCGCCGAGCTGGGCCTCTTTCTCGCATCTCGGGTTATCAGC
GTAGTGTCGACGGTACCGACGCTGGCGGCGCTGTGGCCTGATGAGGCGCTGCGACGGGTTCGGCTTCTGATTCTT
GGTGGTGAGGCCTGTTCGTCGCCGTTGGTGACGAGGCTTGCTGGACCGGGCCGCTGCGTGTGGAAAACTGACGGA
CCGACAGAAGCAACCGTCGTGTCGAGTGTGGCCCGTCTCGAGGTCGGCGAACCGGTCCGAATCGGCCTTCCGCTC
CCCGGCTGGACGCTAGCCGTTGTGGGGCCGGACGGACAGCCGGTACAGTGGGGCCAACCGGGCGAGCTGATCATC
GGCGGCGCGGGAATAGCCCGGTATTTGGACGCGGAGCTGGACAGCAAGCGAATGGCACCGGCCCTCGGCTGGAAG
CGAGCTTACCGCACCGGAGATATAGTCCGAGTCGACCGCGCCGGGCTCGTCTTCCTCGGCCGCGGAGACGATCAG
GTTAAGCTGGCTGGTCGGAGGGTTGAACAGGGTGAGATTGACGCTGCGCTGGCTGACTTGCTGGGCGTAAGGGCG
GCGGCTTGTGCGGTTCGAAGCAGTGAGACTGGCGATGATTTGCTCATCGGCTATATCGTGCGTGAGGATGAGCCG
ACCTCTGCTGATCGAGAGATCCTACTACTGCGTCTTTCCGGCGCACTGGTATCGCTCCTCGCTCGCGTCGACGGC
ATTCCTATGAAGACATCCGGGAAAGCAGACCGTGCCGCGCTGCCATTAACATTGCCCGGAAGCGAGCGTCGGTCC
CGGAACTTGTCTCTGTCCGGCACGGAAGGCTGGCTCGCTGAGCAGCGGCGTCTAGTGCTTGGAAACGAGCCGGCC
GGGTCTGAAGATGATCTCTTTGAGCTGGGAGCTACGAGCTTGTCGGTTGTGCAGCTCATTTCGCTCCTTCGCCGG
CGGTGTCCTACGCTCTCTGTCAAGGATCTATATAGTCATCCGACGTTAGGAGACATGGCTGCCTTGATAGACGGA
CAGGTGGAGACAAAGCACGCGGCTCGAGTTATGAAGCCGATGCCGCGCTTCACCGGCTTCATTCAAGTTTTCGTC
ATCATCGGTATACTAACACTGGAGGGTCTACGCTGGCTCGTCATCCTTATGACTATAGCAAAAGTCACGTCCCTC
GTTCAGAACAATCACGACTTGTGGATAACTCCGCTACCATCCTGGTGGCAGCTCGTCCCAGCCTGGATGCTCCTC
ATCAGCATCCCCGGCCGCGTGCTCGTCACTGCCTTCACCGCCCGACTCCTCACAGCCAGTCTTCGTCCAGGCCGT
TATCCCCGAGGCGGAGCAATCCACCTCGGCCTATGGGCAGCAGAGCGGCTCGTGGAAACAAGCGCAGTCAGCGCC
GTGACCGGAACACACTGGTGCCGGCGCTACGCCCGACTCCTGGAATGCCGCGTTGGGGAAGACGCACAGCTTCAC
TCGGGAATCGTGTCCGGGGCTACTGAAGTTGTCCCAGAGTTGGGGTCCGGCCGTGAAGACGCTGAGACTCAACTT
CCATATGATATCTCGCTGGCTGCTGTTGAGGCTCTGCAGGGCGCTGTCGTGGCTGCTCCCGCACTCATCATCTTC
CCCGTCCTGCTCGCTTTAGATAGTCCGGGACGACAGGCGGTGCTGATGCTGGCCCTTTCCATCCCGGCGACGGCT
GCTAGTGTTCTCGGCTACGCTGGTCTAGTTGCCGTTCTGATCCGCTTTGCCAGCCGCCATCTTCAGAAAGGTTCT
TTTCGTGGCACGGCGTCGAGGCATGGGCAGCCTGGTTTACGATGCGGCTCGTTGCTGATGCTCGCACCGCCCTCT
TCCCCCTATACGCCAGTCTACTAACACCGAGCTGGCTGCGAGCCATGGGATCTCGAGTCGGACGAGGCGTCGAGG
CATCAACCGTTGTCACTATCCCCTCGCTTCTGGAAGTCGGAGACGGAGCCTTTCTCGCCGACGACGTCTTGCTAG
CTCCCTACCGACTGGCAGCGGGAAGACTTCACATCGGCAGCGTGGAGATTAGCACGCGCGCCTTAGTGGGAAACT
GGGCAATGGTCGACTCGGACAATCCAGTTCCAGACGGCGCTCTGATCGGCGTACTGGCTACCGCACCGCCCGCCG
CCGAAGCCGCTGCCTCCGGTCCGGGCTCGGCTTGGCTCGGCCGGCCGGCAATCCCGCTTCCGTACCGGCTCGAAC
CTGGCGAGCGGAGCCAAACTCACGATCCGCCGATTCGTCTTGTGCTTGCTCGCGCTTTTATCGAGTCATGGCGTT
TGCTTCCGCTTGTTCTGTCTGCGCTGCTGGCCGACGCTGTAGCAGCCATCGTGATCTGGTTAGTGGATGTCATCG
GAATCTTGGGAGCCGCAGCATCTGAAGGCATCTTGCCCTTTGGCGGCTACTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail