Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1811
Gene name
LocationContig_18:23591..26603
Strand+
Gene length (bp)3012
Transcript length (bp)3012
Coding sequence length (bp)3012
Protein length (aa) 1004

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.0E-06 476 560
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.8E-10 535 626
PF00023 Ank Ankyrin repeat 6.1E-03 597 626

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 938 2.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 476 982 3.0E-25
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 477 997 6.0E-25
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 476 982 8.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 938 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 938 2.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 476 982 3.0E-25
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 477 997 6.0E-25
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 476 982 8.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 938 1.0E-24
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 480 946 1.0E-24
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 480 946 2.0E-23
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 464 962 2.0E-22
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 464 934 4.0E-22
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 464 934 4.0E-22
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 495 946 2.0E-21
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 495 957 6.0E-21
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 495 957 2.0E-20
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 470 994 5.0E-20
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 476 1003 6.0E-20
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 440 878 8.0E-20
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 476 1003 2.0E-19
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 438 965 2.0E-19
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 488 974 3.0E-19
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 470 994 3.0E-18
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 497 1003 5.0E-18
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 476 935 6.0E-18
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 437 721 7.0E-18
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 470 995 7.0E-18
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 470 994 7.0E-18
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 448 995 1.0E-17
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 447 1000 1.0E-17
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 447 1000 3.0E-17
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 477 716 6.0E-17
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 446 956 3.0E-16
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 401 625 3.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 496 892 5.0E-16
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 448 716 6.0E-16
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 474 718 8.0E-16
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 452 769 1.0E-15
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 448 995 2.0E-15
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 448 716 2.0E-15
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 510 893 2.0E-15
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 436 901 4.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 448 716 4.0E-15
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 497 995 5.0E-15
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 510 893 6.0E-15
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 436 809 9.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 481 837 1.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 437 995 1.0E-14
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 481 837 2.0E-14
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 448 987 2.0E-14
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 448 987 2.0E-14
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 489 724 2.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 471 944 3.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 448 933 5.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 470 996 5.0E-14
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 478 831 8.0E-14
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 477 716 8.0E-14
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 472 953 8.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 448 933 1.0E-13
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 480 769 1.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 477 801 2.0E-13
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 421 769 2.0E-13
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 415 905 2.0E-13
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 506 953 2.0E-13
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 481 809 4.0E-13
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 470 996 4.0E-13
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 477 716 4.0E-13
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 430 995 4.0E-13
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 476 995 7.0E-13
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 489 652 8.0E-13
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 476 995 1.0E-12
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 477 721 1.0E-12
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 437 623 1.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 444 937 2.0E-12
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 477 721 2.0E-12
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 476 809 2.0E-12
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 448 807 3.0E-12
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 447 717 3.0E-12
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 437 652 3.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 448 933 4.0E-12
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 571 938 4.0E-12
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 498 809 4.0E-12
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 436 718 4.0E-12
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 477 716 5.0E-12
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 477 791 6.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 471 933 8.0E-12
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 571 938 9.0E-12
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 448 987 9.0E-12
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 820 1.0E-11
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 501 893 1.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 447 898 1.0E-11
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 561 939 2.0E-11
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 494 717 3.0E-11
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 430 652 3.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 465 625 4.0E-11
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 477 721 4.0E-11
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 497 807 4.0E-11
sp|Q8VHA6|ASB18_MOUSE Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 449 623 4.0E-11
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 477 807 7.0E-11
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 480 693 9.0E-11
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 515 839 1.0E-10
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 496 717 1.0E-10
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 432 959 2.0E-10
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 581 976 2.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 429 716 2.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 559 939 2.0E-10
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 477 717 2.0E-10
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 449 623 2.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 467 729 2.0E-10
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 476 721 2.0E-10
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 447 935 3.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 532 821 3.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 474 733 3.0E-10
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 449 713 3.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 477 807 4.0E-10
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 475 729 4.0E-10
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 581 933 5.0E-10
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 475 729 5.0E-10
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 476 935 5.0E-10
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 437 623 5.0E-10
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 437 623 5.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 447 984 6.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 496 809 7.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 487 936 8.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 464 626 8.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 396 716 8.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 559 895 9.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 434 623 9.0E-10
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 420 675 9.0E-10
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 475 729 1.0E-09
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 476 626 1.0E-09
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 477 652 1.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 447 625 2.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 504 936 2.0E-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 478 709 2.0E-09
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 581 938 2.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 462 935 2.0E-09
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 476 714 2.0E-09
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 510 838 2.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 504 936 3.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 418 814 3.0E-09
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 470 866 3.0E-09
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 656 817 3.0E-09
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 532 817 6.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 698 7.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 432 1001 8.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 571 951 8.0E-09
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 667 942 9.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 580 995 1.0E-08
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 584 811 1.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 571 951 1.0E-08
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 561 902 1.0E-08
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 437 626 1.0E-08
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 704 937 1.0E-08
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 431 714 1.0E-08
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 447 623 1.0E-08
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 470 866 1.0E-08
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 477 716 1.0E-08
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 459 647 1.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 476 721 1.0E-08
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 464 652 1.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 478 995 2.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 418 814 2.0E-08
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 532 810 2.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 437 625 2.0E-08
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 704 937 2.0E-08
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 477 807 2.0E-08
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 494 866 2.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 432 902 2.0E-08
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 534 721 2.0E-08
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 452 626 3.0E-08
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 532 817 3.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 602 938 3.0E-08
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 768 938 3.0E-08
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 447 654 3.0E-08
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 477 716 3.0E-08
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 580 832 3.0E-08
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 420 622 3.0E-08
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 467 647 3.0E-08
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 591 936 4.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 447 984 4.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 534 976 4.0E-08
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 636 906 4.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 480 716 5.0E-08
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 669 982 5.0E-08
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 545 901 5.0E-08
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 723 937 5.0E-08
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 579 718 5.0E-08
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 437 626 5.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 478 709 6.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 420 622 6.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 420 622 6.0E-08
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 448 623 6.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 487 622 6.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 483 564 7.0E-08
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 440 600 7.0E-08
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 420 622 7.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 448 623 7.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 448 895 8.0E-08
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 448 655 8.0E-08
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 448 655 8.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 580 995 9.0E-08
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 470 757 1.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 477 731 1.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 420 622 1.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 435 709 1.0E-07
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 515 802 1.0E-07
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 420 649 1.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 449 644 1.0E-07
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 478 655 1.0E-07
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 448 623 1.0E-07
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 448 623 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 622 986 2.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 659 973 2.0E-07
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 614 1002 2.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 571 952 2.0E-07
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 579 814 2.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 448 623 2.0E-07
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 491 625 2.0E-07
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 440 617 2.0E-07
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 452 625 2.0E-07
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 534 721 2.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 468 623 2.0E-07
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 448 623 2.0E-07
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 448 716 2.0E-07
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 440 600 2.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 452 602 2.0E-07
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 440 600 2.0E-07
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 437 758 2.0E-07
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 477 731 2.0E-07
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 653 985 2.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 476 625 2.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 669 997 3.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 476 743 3.0E-07
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 479 834 3.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 534 882 3.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 399 623 3.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 480 623 3.0E-07
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 479 667 3.0E-07
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 413 860 3.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 495 622 3.0E-07
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 420 622 3.0E-07
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 420 622 3.0E-07
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 452 625 3.0E-07
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 574 718 3.0E-07
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 448 655 3.0E-07
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 440 600 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 559 895 4.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 478 995 4.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 479 995 4.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 431 630 4.0E-07
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 602 897 4.0E-07
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 440 600 4.0E-07
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 448 623 4.0E-07
sp|Q4UKX2|Y950_RICFE Putative ankyrin repeat protein RF_0950 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0950 PE=3 SV=1 433 610 4.0E-07
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 452 625 4.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 622 986 5.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 478 802 5.0E-07
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 485 747 5.0E-07
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 541 726 5.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 511 652 5.0E-07
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 440 600 5.0E-07
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 469 619 5.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 478 623 5.0E-07
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 440 599 5.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 476 651 5.0E-07
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 440 600 6.0E-07
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 479 625 6.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 477 731 6.0E-07
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 431 716 7.0E-07
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 452 625 7.0E-07
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 470 601 7.0E-07
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 477 731 7.0E-07
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 467 678 8.0E-07
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 462 705 8.0E-07
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 440 600 9.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 538 814 9.0E-07
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 491 623 9.0E-07
sp|Q60649|CLPB_MOUSE Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1 653 789 9.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 600 957 1.0E-06
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 591 813 1.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 476 743 1.0E-06
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 431 652 1.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 680 977 1.0E-06
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 534 721 1.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 478 717 1.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 480 625 1.0E-06
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 693 931 1.0E-06
sp|Q91ZU1|ASB6_MOUSE Ankyrin repeat and SOCS box protein 6 OS=Mus musculus GN=Asb6 PE=1 SV=1 509 752 1.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 530 709 1.0E-06
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 480 718 1.0E-06
sp|Q5E9N5|CLPB_BOVIN Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1 653 789 1.0E-06
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 493 656 1.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 530 709 1.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 530 713 1.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 591 938 2.0E-06
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 474 626 2.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 548 936 2.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 482 814 2.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 587 902 2.0E-06
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 587 902 2.0E-06
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 499 902 2.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 475 743 2.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 535 934 2.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 530 713 2.0E-06
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 440 599 2.0E-06
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 462 626 2.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 449 721 2.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 449 721 2.0E-06
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 440 617 2.0E-06
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 574 718 2.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 489 936 2.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 437 731 2.0E-06
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 476 646 2.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 739 1001 3.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 482 814 3.0E-06
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 587 902 3.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 483 995 3.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 530 725 3.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 574 718 3.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 468 622 3.0E-06
sp|Q9NWX5|ASB6_HUMAN Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens GN=ASB6 PE=1 SV=1 509 716 3.0E-06
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 431 626 3.0E-06
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 457 602 3.0E-06
sp|Q5R4M7|ASB6_PONAB Ankyrin repeat and SOCS box protein 6 OS=Pongo abelii GN=ASB6 PE=2 SV=1 509 716 3.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 437 626 3.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 494 631 3.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 476 727 3.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 432 631 3.0E-06
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 440 599 3.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 448 568 4.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 448 568 4.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 478 802 4.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 581 995 4.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 530 709 4.0E-06
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 449 619 4.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 487 718 4.0E-06
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 440 617 4.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 447 726 4.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 464 626 4.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 447 726 4.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 530 709 4.0E-06
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 431 626 4.0E-06
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 449 619 4.0E-06
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 516 623 5.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 437 626 5.0E-06
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 477 718 5.0E-06
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 425 617 5.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 476 652 5.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 602 811 6.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 674 977 6.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 464 625 6.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 680 977 6.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 602 820 6.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 477 625 6.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 471 721 6.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 489 721 6.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 480 718 6.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 580 995 7.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 581 809 7.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 412 809 7.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 494 683 7.0E-06
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 440 600 7.0E-06
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 490 623 7.0E-06
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 479 625 7.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 477 600 7.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 477 718 7.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 580 949 7.0E-06
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 380 830 8.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 492 712 8.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 480 622 8.0E-06
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 491 811 8.0E-06
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 418 608 8.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 465 622 8.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 464 626 8.0E-06
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 643 896 9.0E-06
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 467 651 9.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 593 814 9.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 530 709 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1811
MLKDAPFVSPCRESVASNLNGAIGPSTTSQHRVSLFPPRTDVSSTPRSSPSVPALAAAGAVRSSSPLSVGTIRSS
STARPSSVSTARSQHHHRPLDSSGHRRNGNMATCGKAQAQCLELCHNIASAGDAVAERMAEYSTIVKHVPFGFNG
LANELLDVCHVLFYIEAGLEEAVCNAHPLPLEMITVLEKRFRAAQADFKSLDHTVGKWLDNERRGAVGRMRRGFG
KVFGKDGIDKMLLALQRHRTELKMSALMFQWNLGSDRIESDPGIGYIALNATLEDSNIRRKHESMAFGNAAEDRP
PSASSSIHHSKTSSRQRQVNAVTHDSKPQTRESKVIPFSPDSTSGESGSFTAPLSDFGHGTPSTHLTASSSGSHD
RSDGLDEVPELSLELETLVADVVGPILDSSVVETREHEASAMPRRRSRSSTESDKVSSKHALVSAIRTKDHRLVS
QLLDRGVSPNTGPDAHAVNESIAIQDVESLRLLLLYGADPDALDRDGLSPLGAAVRGSLLSAAALLLKYGADVDM
EPTLGMERPLAVAVASGNPRMTRLLLMYGAGPNQQTADGDTLLICGIGKKTPKRLIESLLMYGSNVNDKNRDGKT
ALFEAIQSARADIVTLLLNKGADPNLPGPKHMLWPAASQPPCLEVLLAHGADYKKCPGIMELATSINRVESVQML
LNAGVDPNSKKDGVYTPLCTSIRDNRGDIFQLLLAKGADPNLKASEYPAFKCVTHHREHFLPALVAAGARLNTPK
GILETAVSSNNGQALGWLLDQGLDPDDKNAKGHTALTSAIRDNRAIFVDTLLAHGANPNIRGQDWPLCMAVQHPG
ILKRILETLPEPRAFKGVVEMAVVANQLESIKLLLAAGVSVEDRNGGVFSPLTTALRERRREIVRFLIEEGGADV
NAPGEHLPIVKALRRCQEEEHQDMIEMLLNKGADPNKVYRGWNGVMQALENGDAAMLARVCAKSGVDLDVKDELG
RNVTEIAVSRRWEEAVNILLGNAIKTSS*
Coding >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG
Transcript >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG
Gene >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail