Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1811
Gene name
LocationContig_18:23591..26603
Strand+
Gene length (bp)3012
Transcript length (bp)3012
Coding sequence length (bp)3012
Protein length (aa) 1004

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.0E-06 476 560
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.8E-10 535 626
PF00023 Ank Ankyrin repeat 6.1E-03 597 626

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 938 2.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 476 982 3.0E-25
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 477 997 6.0E-25
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 476 982 8.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 938 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 938 2.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 476 982 3.0E-25
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 477 997 6.0E-25
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 476 982 8.0E-25
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 938 1.0E-24
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 480 946 1.0E-24
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 480 946 2.0E-23
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 464 962 2.0E-22
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 464 934 4.0E-22
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 464 934 4.0E-22
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 495 946 2.0E-21
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 495 957 6.0E-21
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 495 957 2.0E-20
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 470 994 5.0E-20
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 476 1003 6.0E-20
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 440 878 8.0E-20
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 476 1003 2.0E-19
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 438 965 2.0E-19
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 488 974 3.0E-19
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 470 994 3.0E-18
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 497 1003 5.0E-18
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 476 935 6.0E-18
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 437 721 7.0E-18
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 470 995 7.0E-18
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 470 994 7.0E-18
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 448 995 1.0E-17
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 447 1000 1.0E-17
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 447 1000 3.0E-17
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 477 716 6.0E-17
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 446 956 3.0E-16
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 401 625 3.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 496 892 5.0E-16
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 448 716 6.0E-16
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 474 718 8.0E-16
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 452 769 1.0E-15
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 448 995 2.0E-15
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 448 716 2.0E-15
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 510 893 2.0E-15
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 436 901 4.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 448 716 4.0E-15
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 497 995 5.0E-15
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 510 893 6.0E-15
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 436 809 9.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 481 837 1.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 437 995 1.0E-14
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 481 837 2.0E-14
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 448 987 2.0E-14
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 448 987 2.0E-14
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 489 724 2.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 471 944 3.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 448 933 5.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 470 996 5.0E-14
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 478 831 8.0E-14
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 477 716 8.0E-14
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 472 953 8.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 448 933 1.0E-13
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 480 769 1.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 477 801 2.0E-13
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 421 769 2.0E-13
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 415 905 2.0E-13
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 506 953 2.0E-13
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 481 809 4.0E-13
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 470 996 4.0E-13
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 477 716 4.0E-13
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 430 995 4.0E-13
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 476 995 7.0E-13
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 489 652 8.0E-13
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 476 995 1.0E-12
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 477 721 1.0E-12
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 437 623 1.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 444 937 2.0E-12
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 477 721 2.0E-12
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 476 809 2.0E-12
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 448 807 3.0E-12
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 447 717 3.0E-12
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 437 652 3.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 448 933 4.0E-12
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 571 938 4.0E-12
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 498 809 4.0E-12
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 436 718 4.0E-12
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 477 716 5.0E-12
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 477 791 6.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 471 933 8.0E-12
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 571 938 9.0E-12
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 448 987 9.0E-12
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 448 820 1.0E-11
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 501 893 1.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 447 898 1.0E-11
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 561 939 2.0E-11
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 494 717 3.0E-11
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 430 652 3.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 465 625 4.0E-11
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 477 721 4.0E-11
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 497 807 4.0E-11
sp|Q8VHA6|ASB18_MOUSE Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 449 623 4.0E-11
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 477 807 7.0E-11
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 480 693 9.0E-11
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 515 839 1.0E-10
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 496 717 1.0E-10
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 432 959 2.0E-10
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 581 976 2.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 429 716 2.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 559 939 2.0E-10
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 477 717 2.0E-10
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 449 623 2.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 467 729 2.0E-10
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 476 721 2.0E-10
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 447 935 3.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 532 821 3.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 474 733 3.0E-10
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 449 713 3.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 477 807 4.0E-10
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 475 729 4.0E-10
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 581 933 5.0E-10
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 475 729 5.0E-10
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 476 935 5.0E-10
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 437 623 5.0E-10
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 437 623 5.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 447 984 6.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 496 809 7.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 487 936 8.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 464 626 8.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 396 716 8.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 559 895 9.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 434 623 9.0E-10
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 420 675 9.0E-10
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 475 729 1.0E-09
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 476 626 1.0E-09
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 477 652 1.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 447 625 2.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 504 936 2.0E-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 478 709 2.0E-09
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 581 938 2.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 462 935 2.0E-09
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 476 714 2.0E-09
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 510 838 2.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 504 936 3.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 418 814 3.0E-09
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 470 866 3.0E-09
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 656 817 3.0E-09
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 532 817 6.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 448 698 7.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 432 1001 8.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 571 951 8.0E-09
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 667 942 9.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 580 995 1.0E-08
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 584 811 1.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 571 951 1.0E-08
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 561 902 1.0E-08
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 437 626 1.0E-08
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 704 937 1.0E-08
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 431 714 1.0E-08
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 447 623 1.0E-08
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 470 866 1.0E-08
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 477 716 1.0E-08
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 459 647 1.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 476 721 1.0E-08
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 464 652 1.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 478 995 2.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 418 814 2.0E-08
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 532 810 2.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 437 625 2.0E-08
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 704 937 2.0E-08
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 477 807 2.0E-08
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 494 866 2.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 432 902 2.0E-08
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 534 721 2.0E-08
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 452 626 3.0E-08
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 532 817 3.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 602 938 3.0E-08
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 768 938 3.0E-08
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 447 654 3.0E-08
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 477 716 3.0E-08
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 580 832 3.0E-08
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 420 622 3.0E-08
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 467 647 3.0E-08
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 591 936 4.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 447 984 4.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 534 976 4.0E-08
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 636 906 4.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 480 716 5.0E-08
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 669 982 5.0E-08
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 545 901 5.0E-08
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 723 937 5.0E-08
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 579 718 5.0E-08
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 437 626 5.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 478 709 6.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 420 622 6.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 420 622 6.0E-08
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 448 623 6.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 487 622 6.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 483 564 7.0E-08
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 440 600 7.0E-08
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 420 622 7.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 448 623 7.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 448 895 8.0E-08
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 448 655 8.0E-08
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 448 655 8.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 580 995 9.0E-08
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 470 757 1.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 477 731 1.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 420 622 1.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 435 709 1.0E-07
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 515 802 1.0E-07
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 420 649 1.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 449 644 1.0E-07
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 478 655 1.0E-07
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 448 623 1.0E-07
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 448 623 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 622 986 2.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 659 973 2.0E-07
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 614 1002 2.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 571 952 2.0E-07
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 579 814 2.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 448 623 2.0E-07
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 491 625 2.0E-07
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 440 617 2.0E-07
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 452 625 2.0E-07
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 534 721 2.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 468 623 2.0E-07
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 448 623 2.0E-07
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 448 716 2.0E-07
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 440 600 2.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 452 602 2.0E-07
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 440 600 2.0E-07
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 437 758 2.0E-07
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 477 731 2.0E-07
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 653 985 2.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 476 625 2.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 669 997 3.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 476 743 3.0E-07
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 479 834 3.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 534 882 3.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 399 623 3.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 480 623 3.0E-07
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 479 667 3.0E-07
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 413 860 3.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 495 622 3.0E-07
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 420 622 3.0E-07
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 420 622 3.0E-07
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 452 625 3.0E-07
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 574 718 3.0E-07
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 448 655 3.0E-07
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 440 600 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 559 895 4.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 478 995 4.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 479 995 4.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 431 630 4.0E-07
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 602 897 4.0E-07
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 440 600 4.0E-07
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 448 623 4.0E-07
sp|Q4UKX2|Y950_RICFE Putative ankyrin repeat protein RF_0950 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0950 PE=3 SV=1 433 610 4.0E-07
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 452 625 4.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 622 986 5.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 478 802 5.0E-07
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 485 747 5.0E-07
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 541 726 5.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 511 652 5.0E-07
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 440 600 5.0E-07
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 469 619 5.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 478 623 5.0E-07
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 440 599 5.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 476 651 5.0E-07
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 440 600 6.0E-07
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 479 625 6.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 477 731 6.0E-07
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 431 716 7.0E-07
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 452 625 7.0E-07
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 470 601 7.0E-07
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 477 731 7.0E-07
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 467 678 8.0E-07
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 462 705 8.0E-07
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 440 600 9.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 538 814 9.0E-07
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 491 623 9.0E-07
sp|Q60649|CLPB_MOUSE Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1 653 789 9.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 600 957 1.0E-06
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 591 813 1.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 476 743 1.0E-06
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 431 652 1.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 680 977 1.0E-06
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 534 721 1.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 478 717 1.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 480 625 1.0E-06
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 693 931 1.0E-06
sp|Q91ZU1|ASB6_MOUSE Ankyrin repeat and SOCS box protein 6 OS=Mus musculus GN=Asb6 PE=1 SV=1 509 752 1.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 530 709 1.0E-06
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 480 718 1.0E-06
sp|Q5E9N5|CLPB_BOVIN Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1 653 789 1.0E-06
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 493 656 1.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 530 709 1.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 530 713 1.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 591 938 2.0E-06
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 474 626 2.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 548 936 2.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 482 814 2.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 587 902 2.0E-06
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 587 902 2.0E-06
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 499 902 2.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 475 743 2.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 535 934 2.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 530 713 2.0E-06
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 440 599 2.0E-06
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 462 626 2.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 449 721 2.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 449 721 2.0E-06
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 440 617 2.0E-06
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 574 718 2.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 489 936 2.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 437 731 2.0E-06
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 476 646 2.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 739 1001 3.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 482 814 3.0E-06
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 587 902 3.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 483 995 3.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 530 725 3.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 574 718 3.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 468 622 3.0E-06
sp|Q9NWX5|ASB6_HUMAN Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens GN=ASB6 PE=1 SV=1 509 716 3.0E-06
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 431 626 3.0E-06
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 457 602 3.0E-06
sp|Q5R4M7|ASB6_PONAB Ankyrin repeat and SOCS box protein 6 OS=Pongo abelii GN=ASB6 PE=2 SV=1 509 716 3.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 437 626 3.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 494 631 3.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 476 727 3.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 432 631 3.0E-06
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 440 599 3.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 448 568 4.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 448 568 4.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 478 802 4.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 581 995 4.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 530 709 4.0E-06
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 449 619 4.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 487 718 4.0E-06
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 440 617 4.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 447 726 4.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 464 626 4.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 447 726 4.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 530 709 4.0E-06
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 431 626 4.0E-06
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 449 619 4.0E-06
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 516 623 5.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 437 626 5.0E-06
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 477 718 5.0E-06
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 425 617 5.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 476 652 5.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 602 811 6.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 674 977 6.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 464 625 6.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 680 977 6.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 602 820 6.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 477 625 6.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 471 721 6.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 489 721 6.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 480 718 6.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 580 995 7.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 581 809 7.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 412 809 7.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 494 683 7.0E-06
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 440 600 7.0E-06
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 490 623 7.0E-06
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 479 625 7.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 477 600 7.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 477 718 7.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 580 949 7.0E-06
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 380 830 8.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 492 712 8.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 480 622 8.0E-06
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 491 811 8.0E-06
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 418 608 8.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 465 622 8.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 464 626 8.0E-06
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 643 896 9.0E-06
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 467 651 9.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 593 814 9.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 530 709 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 9 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6726
Ophiocordyceps australis map64 (Brazil) OphauB2|4627
Ophiocordyceps camponoti-floridani Ophcf2|02887
Ophiocordyceps camponoti-rufipedis Ophun1|1811 (this protein)
Ophiocordyceps kimflemingae Ophio5|5707
Ophiocordyceps subramaniannii Hirsu2|7269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1811
MLKDAPFVSPCRESVASNLNGAIGPSTTSQHRVSLFPPRTDVSSTPRSSPSVPALAAAGAVRSSSPLSVGTIRSS
STARPSSVSTARSQHHHRPLDSSGHRRNGNMATCGKAQAQCLELCHNIASAGDAVAERMAEYSTIVKHVPFGFNG
LANELLDVCHVLFYIEAGLEEAVCNAHPLPLEMITVLEKRFRAAQADFKSLDHTVGKWLDNERRGAVGRMRRGFG
KVFGKDGIDKMLLALQRHRTELKMSALMFQWNLGSDRIESDPGIGYIALNATLEDSNIRRKHESMAFGNAAEDRP
PSASSSIHHSKTSSRQRQVNAVTHDSKPQTRESKVIPFSPDSTSGESGSFTAPLSDFGHGTPSTHLTASSSGSHD
RSDGLDEVPELSLELETLVADVVGPILDSSVVETREHEASAMPRRRSRSSTESDKVSSKHALVSAIRTKDHRLVS
QLLDRGVSPNTGPDAHAVNESIAIQDVESLRLLLLYGADPDALDRDGLSPLGAAVRGSLLSAAALLLKYGADVDM
EPTLGMERPLAVAVASGNPRMTRLLLMYGAGPNQQTADGDTLLICGIGKKTPKRLIESLLMYGSNVNDKNRDGKT
ALFEAIQSARADIVTLLLNKGADPNLPGPKHMLWPAASQPPCLEVLLAHGADYKKCPGIMELATSINRVESVQML
LNAGVDPNSKKDGVYTPLCTSIRDNRGDIFQLLLAKGADPNLKASEYPAFKCVTHHREHFLPALVAAGARLNTPK
GILETAVSSNNGQALGWLLDQGLDPDDKNAKGHTALTSAIRDNRAIFVDTLLAHGANPNIRGQDWPLCMAVQHPG
ILKRILETLPEPRAFKGVVEMAVVANQLESIKLLLAAGVSVEDRNGGVFSPLTTALRERRREIVRFLIEEGGADV
NAPGEHLPIVKALRRCQEEEHQDMIEMLLNKGADPNKVYRGWNGVMQALENGDAAMLARVCAKSGVDLDVKDELG
RNVTEIAVSRRWEEAVNILLGNAIKTSS*
Coding >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG
Transcript >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG
Gene >Ophun1|1811
ATGTTGAAAGACGCCCCCTTCGTCTCTCCTTGTCGAGAGTCCGTTGCTTCCAACCTCAACGGTGCCATCGGTCCG
TCCACGACTTCGCAGCACCGGGTCTCTCTGTTTCCGCCCCGGACTGACGTCTCGTCGACGCCGCGATCGTCGCCT
TCTGTCCCTGCCCTTGCTGCCGCCGGTGCCGTACGCTCGTCGTCGCCATTGTCCGTGGGGACCATACGGTCGTCC
TCAACGGCCCGGCCCTCTTCGGTTTCCACCGCCCGATCCCAACATCACCACCGGCCGCTGGACTCTTCGGGCCAC
CGCCGCAACGGCAACATGGCCACTTGCGGCAAGGCCCAGGCGCAGTGCCTCGAGCTCTGCCACAACATTGCCAGC
GCCGGCGATGCCGTTGCCGAGCGCATGGCCGAGTACTCGACCATCGTCAAGCACGTTCCCTTTGGATTCAACGGT
CTGGCTAATGAGCTGCTCGACGTCTGCCATGTCCTGTTCTACATCGAAGCCGGGCTCGAAGAAGCCGTTTGCAAT
GCTCACCCGCTACCCCTCGAGATGATCACCGTGCTGGAAAAGAGGTTCCGCGCGGCCCAGGCCGACTTCAAGTCT
CTGGATCACACCGTCGGCAAGTGGCTTGATAATGAGCGTCGCGGTGCCGTTGGCCGCATGCGTCGCGGCTTCGGC
AAGGTCTTTGGAAAGGACGGCATCGACAAGATGCTGCTTGCCCTTCAGCGGCATCGCACCGAGCTCAAGATGAGC
GCCCTCATGTTCCAATGGAATCTTGGGTCTGACCGGATTGAAAGCGACCCCGGCATCGGCTACATCGCGCTCAAC
GCCACTCTCGAAGACAGCAACATTCGGCGCAAACACGAATCAATGGCTTTTGGCAACGCGGCGGAAGATAGACCG
CCGTCGGCGTCATCATCGATTCATCACTCCAAAACTTCGTCGCGGCAGAGACAAGTCAACGCGGTGACGCACGAC
TCCAAGCCGCAGACCAGGGAATCCAAGGTGATTCCCTTCAGCCCAGACTCGACGAGCGGCGAAAGCGGCAGCTTC
ACAGCTCCATTGTCCGACTTTGGTCACGGTACTCCATCCACCCACCTCACCGCGAGCTCCTCGGGCTCACATGAC
CGTTCAGACGGCCTCGACGAGGTGCCCGAGCTGAGTCTCGAGCTTGAGACGCTCGTCGCCGACGTTGTTGGCCCG
ATATTGGATAGTTCGGTCGTGGAGACACGCGAGCACGAGGCTTCGGCCATGCCCAGACGTCGATCGCGCAGCAGC
ACCGAGAGCGACAAGGTGAGCTCCAAGCACGCGCTCGTCTCAGCTATCCGCACCAAGGACCACAGGCTCGTCTCG
CAACTCCTTGACCGCGGCGTGTCGCCCAACACGGGCCCGGATGCGCACGCTGTCAACGAATCCATCGCCATTCAA
GACGTCGAGAGTCTGCGGCTCCTACTCCTGTACGGCGCGGACCCGGACGCTCTCGACAGGGACGGACTGAGCCCC
CTCGGAGCCGCCGTCCGTGGATCTCTCCTCTCCGCCGCGGCGCTCCTCCTCAAGTACGGCGCCGACGTCGACATG
GAGCCGACTCTCGGGATGGAGAGGCCGCTGGCCGTCGCAGTGGCCAGCGGTAACCCGCGGATGACGCGCCTCCTG
CTGATGTACGGCGCCGGCCCCAACCAGCAGACGGCCGACGGCGACACGCTCCTCATCTGCGGCATCGGAAAGAAG
ACGCCCAAGCGGTTGATAGAGTCGCTGTTGATGTACGGGTCCAACGTCAACGACAAGAACCGCGACGGCAAGACG
GCCCTGTTCGAGGCCATTCAGAGCGCGAGGGCCGACATCGTCACGCTGCTGCTGAACAAGGGCGCGGACCCGAAC
CTGCCGGGGCCCAAGCACATGCTGTGGCCGGCCGCGTCTCAGCCTCCTTGCCTCGAGGTTCTCCTTGCGCACGGA
GCCGACTACAAGAAGTGTCCGGGCATCATGGAGCTGGCGACGAGCATCAATCGGGTTGAGTCGGTGCAGATGCTG
CTGAACGCGGGCGTTGACCCCAACTCCAAAAAGGACGGTGTGTATACGCCGCTCTGCACTTCGATCCGTGATAAC
CGCGGCGACATCTTTCAGCTGCTGCTGGCCAAGGGGGCGGACCCGAATCTCAAGGCCAGCGAGTATCCGGCCTTC
AAGTGCGTTACGCACCACCGCGAGCACTTCCTGCCGGCTCTGGTGGCGGCCGGCGCGCGGCTTAACACGCCCAAG
GGCATCTTGGAGACTGCCGTGTCGTCGAACAATGGCCAGGCGCTGGGCTGGCTGCTGGATCAGGGCCTGGATCCT
GATGACAAGAACGCCAAGGGTCACACGGCATTAACGAGCGCCATACGCGATAACCGCGCCATTTTTGTTGACACA
CTACTTGCGCACGGGGCCAATCCCAATATCCGCGGCCAAGACTGGCCCTTGTGTATGGCGGTCCAGCACCCGGGC
ATTCTCAAGCGCATACTGGAGACGCTGCCGGAGCCGCGGGCCTTCAAGGGCGTGGTGGAGATGGCCGTGGTGGCC
AACCAGCTCGAGTCGATCAAGCTGCTCCTGGCGGCTGGCGTGTCGGTCGAGGATCGCAATGGAGGCGTCTTCTCG
CCCCTGACGACGGCCCTGCGCGAGCGACGACGTGAGATCGTGCGGTTCCTGATCGAAGAGGGCGGCGCCGACGTC
AACGCGCCGGGCGAGCATCTGCCCATCGTCAAGGCGTTGCGACGGTGTCAGGAGGAGGAGCACCAGGACATGATT
GAGATGCTGCTGAACAAGGGCGCCGACCCGAACAAGGTGTACCGCGGATGGAACGGCGTCATGCAGGCGCTGGAG
AATGGCGACGCGGCGATGCTGGCGCGGGTGTGTGCCAAGTCGGGGGTCGATCTGGACGTCAAGGATGAGCTGGGC
CGCAACGTGACGGAGATCGCCGTGTCGAGACGGTGGGAGGAGGCTGTGAATATCCTGTTGGGTAATGCCATCAAG
ACGTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail