Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1802
Gene name
LocationContig_18:5612..8018
Strand+
Gene length (bp)2406
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 8.3E-99 114 671
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 2.6E-14 176 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 74 740 3.0E-126
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 74 740 4.0E-125
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 74 740 5.0E-125
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 74 740 8.0E-125
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 74 740 3.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 74 740 3.0E-126
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 74 740 4.0E-125
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 74 740 5.0E-125
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 74 740 8.0E-125
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 74 740 3.0E-123
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 74 740 5.0E-123
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 73 740 9.0E-97
sp|O13939|AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl6 PE=1 SV=1 33 741 2.0E-81
sp|Q759E2|AP3B_ASHGO AP-3 complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL6 PE=3 SV=2 36 707 7.0E-78
sp|P46682|AP3B_YEAST AP-3 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL6 PE=1 SV=2 35 690 1.0E-77
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 124 686 6.0E-56
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 124 686 1.0E-55
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 124 686 1.0E-53
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 124 686 2.0E-53
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 124 686 2.0E-53
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 124 686 2.0E-53
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 124 686 2.0E-53
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 124 686 3.0E-53
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 124 686 4.0E-52
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 124 686 3.0E-49
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 124 686 7.0E-47
sp|Q9M2T1|AP3BA_ARATH AP3-complex subunit beta-A OS=Arabidopsis thaliana GN=AP3BA PE=2 SV=2 184 672 3.0E-40
sp|O43079|AP1B1_SCHPO AP-1 complex subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl2 PE=1 SV=1 124 671 3.0E-34
sp|O43005|AP2B_SCHPO AP-2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl1 PE=3 SV=1 124 686 2.0E-33
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 125 599 2.0E-29
sp|Q9Y6B7|AP4B1_HUMAN AP-4 complex subunit beta-1 OS=Homo sapiens GN=AP4B1 PE=1 SV=2 125 592 3.0E-28
sp|Q9WV76|AP4B1_MOUSE AP-4 complex subunit beta-1 OS=Mus musculus GN=Ap4b1 PE=1 SV=2 125 598 1.0E-27
sp|P36000|AP1B1_YEAST AP-1 complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL2 PE=1 SV=1 113 604 4.0E-27
sp|Q54R84|AP4B_DICDI AP-4 complex subunit beta OS=Dictyostelium discoideum GN=ap4b1 PE=3 SV=1 69 497 1.0E-21
sp|P27351|AP2B_YEAST AP-2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL1 PE=1 SV=2 359 636 1.0E-10
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 54 607 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 93 115 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1802
MSANARDQPNTHRPPAKLPPAPKPFSSQPSPKAGMESVSRISGLMETARELTLDAAQATRGARVGARSLDRGQMK
KLLDSRNDREVLDGLRRVVSVGPVLLFVWLRLLMGFSQMMYRNQKTLPFFSSVVKNVASPNLEIKKLVYIYLIHH
AEHEPDLALLSINTIQKSLSDPNPQVRALALKTMSGIRVPVISQIVALAIRKGVADMSPYVRKAAALAIPKCYRL
DPAQSPQLTDCLATLLGDRQFYVAGAAVSAFLEICPSRIDLIHKHYRGLLRKVVDMDEWSQLALLRLMTYYARRC
FPRRTRPSGSSHDSRSAERGNGIDDFYGESPATPSASHGPGVVASLDPDLVLLLNSIRPLLQSRNSGVVMAVTRC
YVDVGTPEYVKLAVGPLVALLRAAQDIQQIALYNIVSVCLAHPGDFVKYASHFLVRATDAPPVWELKLEVLTIIF
PHGSPHVKSLILKELEHFSRGSSKALVREAVRAIGRCAQSDAATAPRCLKLLLGQISSLDGTLAAESLTVIRHLI
QQDSEAHVGTVVRLAKNLDSATDPQARATIIWLVGEFSGLNGEDNIAPDVLRILVRDFASESEPAKRQILLLAAK
VYLHHLNRSAAATEEEADKQTDALESEYLPPPRDETQPHPIPRLWEYVLLLVRYDSSYDLRDRARMYRSLLGVPQ
LATLMLLAPKPAPQAPSPSESRRGFPLGSSTLVLADAVGVHGLRGYETLPDWVSPGQEPDAKLRDGQNQGGGAFV
GFVCGAEWVG*
Coding >Ophun1|1802
ATGTCCGCCAACGCACGTGACCAACCCAACACCCACCGGCCACCGGCGAAGCTTCCTCCCGCCCCCAAGCCCTTC
TCTTCGCAGCCTTCGCCCAAAGCTGGCATGGAGTCAGTATCCCGGATCTCGGGCCTCATGGAGACGGCGAGAGAG
CTGACGCTCGATGCCGCACAAGCCACGCGCGGCGCTCGCGTTGGCGCCCGTTCGCTCGATCGAGGCCAGATGAAG
AAGCTTCTCGACAGTAGGAATGATCGCGAAGTTCTCGACGGCTTGCGGCGCGTTGTCTCTGTTGGTCCTGTGTTG
CTGTTTGTCTGGCTGCGTCTGCTGATGGGATTTTCGCAGATGATGTATCGCAATCAGAAGACGCTGCCTTTTTTC
TCGTCCGTCGTCAAAAACGTCGCCTCTCCCAATCTCGAGATCAAGAAGCTTGTTTACATCTATCTCATCCACCAT
GCCGAGCACGAACCCGACCTCGCCCTTCTCTCCATCAACACCATACAGAAATCGCTGTCCGACCCCAACCCCCAG
GTCCGCGCCCTGGCCCTAAAGACCATGTCCGGCATCCGCGTACCCGTCATCAGCCAGATCGTCGCCCTGGCCATC
AGAAAGGGCGTCGCAGACATGAGTCCCTACGTACGGAAAGCAGCTGCTCTCGCCATCCCCAAGTGTTACCGTCTC
GATCCCGCCCAGTCGCCACAACTCACCGACTGCCTTGCCACCCTCCTCGGCGACAGGCAGTTTTACGTTGCCGGT
GCCGCCGTCTCGGCTTTTCTGGAGATATGCCCTAGTCGCATCGACCTGATACATAAGCACTATCGGGGTCTGCTG
CGCAAGGTCGTCGACATGGACGAATGGAGTCAGCTGGCTCTCCTGCGTCTCATGACATATTACGCGCGGAGGTGT
TTTCCCCGGAGGACTCGGCCGTCGGGCTCGTCGCATGATTCGCGGTCAGCCGAGCGAGGAAACGGCATCGACGAC
TTCTACGGCGAGTCGCCAGCTACACCATCCGCCAGCCACGGCCCCGGCGTCGTCGCCTCCTTGGATCCAGATCTG
GTGCTCCTCCTCAACTCCATCAGGCCGTTGCTCCAGAGCCGCAACTCGGGCGTCGTCATGGCGGTCACGCGCTGC
TACGTCGACGTCGGTACGCCCGAATACGTCAAGCTCGCCGTCGGCCCGCTCGTCGCCCTCCTCCGAGCGGCGCAG
GACATCCAGCAAATCGCCCTCTATAACATCGTCTCCGTCTGTCTTGCTCATCCTGGCGACTTTGTCAAGTACGCG
AGCCACTTCCTCGTCCGGGCCACGGACGCTCCCCCCGTCTGGGAGCTCAAGCTCGAGGTGCTCACCATCATCTTC
CCTCACGGCTCGCCCCACGTCAAGAGCCTCATCCTCAAGGAGCTTGAGCACTTTTCACGCGGCTCTAGCAAGGCC
CTGGTTCGCGAGGCCGTCCGCGCCATTGGCCGTTGTGCCCAGTCGGACGCCGCCACGGCACCCCGTTGCTTGAAG
CTGCTTCTCGGCCAGATCTCCAGCCTCGACGGCACCCTCGCGGCCGAGTCTCTTACGGTGATTCGCCATCTGATT
CAGCAGGATTCCGAGGCGCACGTCGGCACCGTCGTCAGGCTCGCCAAGAATCTCGACTCTGCGACGGATCCGCAG
GCCAGAGCCACCATCATCTGGCTCGTTGGCGAGTTCTCGGGTCTGAATGGCGAGGACAACATCGCGCCGGATGTT
CTCCGCATCCTCGTCAGGGACTTTGCCAGCGAGTCGGAGCCAGCGAAGCGGCAAATCCTACTCCTCGCTGCTAAA
GTCTACCTCCACCACCTCAACCGCTCCGCCGCTGCCACCGAGGAGGAAGCAGACAAGCAGACAGATGCTCTAGAA
AGCGAGTATCTCCCTCCACCCCGAGACGAGACGCAGCCGCACCCCATTCCGCGGCTGTGGGAGTACGTCCTCCTC
CTCGTCCGCTACGACAGCTCCTACGACCTCCGCGACCGAGCAAGGATGTACCGCTCTCTCCTCGGCGTCCCCCAG
CTCGCAACGCTCATGCTCCTGGCGCCCAAGCCAGCCCCCCAAGCGCCCAGCCCATCCGAGTCCCGCCGCGGCTTC
CCCCTAGGATCCTCAACGCTCGTCCTCGCCGACGCGGTCGGCGTCCACGGCCTGAGAGGCTACGAGACGCTACCG
GATTGGGTGTCCCCCGGCCAGGAGCCTGACGCCAAGCTACGCGATGGGCAGAACCAGGGGGGCGGTGCCTTTGTC
GGCTTCGTCTGCGGCGCCGAATGGGTTGGGTGA
Transcript >Ophun1|1802
ATGTCCGCCAACGCACGTGACCAACCCAACACCCACCGGCCACCGGCGAAGCTTCCTCCCGCCCCCAAGCCCTTC
TCTTCGCAGCCTTCGCCCAAAGCTGGCATGGAGTCAGTATCCCGGATCTCGGGCCTCATGGAGACGGCGAGAGAG
CTGACGCTCGATGCCGCACAAGCCACGCGCGGCGCTCGCGTTGGCGCCCGTTCGCTCGATCGAGGCCAGATGAAG
AAGCTTCTCGACAGTAGGAATGATCGCGAAGTTCTCGACGGCTTGCGGCGCGTTGTCTCTGTTGGTCCTGTGTTG
CTGTTTGTCTGGCTGCGTCTGCTGATGGGATTTTCGCAGATGATGTATCGCAATCAGAAGACGCTGCCTTTTTTC
TCGTCCGTCGTCAAAAACGTCGCCTCTCCCAATCTCGAGATCAAGAAGCTTGTTTACATCTATCTCATCCACCAT
GCCGAGCACGAACCCGACCTCGCCCTTCTCTCCATCAACACCATACAGAAATCGCTGTCCGACCCCAACCCCCAG
GTCCGCGCCCTGGCCCTAAAGACCATGTCCGGCATCCGCGTACCCGTCATCAGCCAGATCGTCGCCCTGGCCATC
AGAAAGGGCGTCGCAGACATGAGTCCCTACGTACGGAAAGCAGCTGCTCTCGCCATCCCCAAGTGTTACCGTCTC
GATCCCGCCCAGTCGCCACAACTCACCGACTGCCTTGCCACCCTCCTCGGCGACAGGCAGTTTTACGTTGCCGGT
GCCGCCGTCTCGGCTTTTCTGGAGATATGCCCTAGTCGCATCGACCTGATACATAAGCACTATCGGGGTCTGCTG
CGCAAGGTCGTCGACATGGACGAATGGAGTCAGCTGGCTCTCCTGCGTCTCATGACATATTACGCGCGGAGGTGT
TTTCCCCGGAGGACTCGGCCGTCGGGCTCGTCGCATGATTCGCGGTCAGCCGAGCGAGGAAACGGCATCGACGAC
TTCTACGGCGAGTCGCCAGCTACACCATCCGCCAGCCACGGCCCCGGCGTCGTCGCCTCCTTGGATCCAGATCTG
GTGCTCCTCCTCAACTCCATCAGGCCGTTGCTCCAGAGCCGCAACTCGGGCGTCGTCATGGCGGTCACGCGCTGC
TACGTCGACGTCGGTACGCCCGAATACGTCAAGCTCGCCGTCGGCCCGCTCGTCGCCCTCCTCCGAGCGGCGCAG
GACATCCAGCAAATCGCCCTCTATAACATCGTCTCCGTCTGTCTTGCTCATCCTGGCGACTTTGTCAAGTACGCG
AGCCACTTCCTCGTCCGGGCCACGGACGCTCCCCCCGTCTGGGAGCTCAAGCTCGAGGTGCTCACCATCATCTTC
CCTCACGGCTCGCCCCACGTCAAGAGCCTCATCCTCAAGGAGCTTGAGCACTTTTCACGCGGCTCTAGCAAGGCC
CTGGTTCGCGAGGCCGTCCGCGCCATTGGCCGTTGTGCCCAGTCGGACGCCGCCACGGCACCCCGTTGCTTGAAG
CTGCTTCTCGGCCAGATCTCCAGCCTCGACGGCACCCTCGCGGCCGAGTCTCTTACGGTGATTCGCCATCTGATT
CAGCAGGATTCCGAGGCGCACGTCGGCACCGTCGTCAGGCTCGCCAAGAATCTCGACTCTGCGACGGATCCGCAG
GCCAGAGCCACCATCATCTGGCTCGTTGGCGAGTTCTCGGGTCTGAATGGCGAGGACAACATCGCGCCGGATGTT
CTCCGCATCCTCGTCAGGGACTTTGCCAGCGAGTCGGAGCCAGCGAAGCGGCAAATCCTACTCCTCGCTGCTAAA
GTCTACCTCCACCACCTCAACCGCTCCGCCGCTGCCACCGAGGAGGAAGCAGACAAGCAGACAGATGCTCTAGAA
AGCGAGTATCTCCCTCCACCCCGAGACGAGACGCAGCCGCACCCCATTCCGCGGCTGTGGGAGTACGTCCTCCTC
CTCGTCCGCTACGACAGCTCCTACGACCTCCGCGACCGAGCAAGGATGTACCGCTCTCTCCTCGGCGTCCCCCAG
CTCGCAACGCTCATGCTCCTGGCGCCCAAGCCAGCCCCCCAAGCGCCCAGCCCATCCGAGTCCCGCCGCGGCTTC
CCCCTAGGATCCTCAACGCTCGTCCTCGCCGACGCGGTCGGCGTCCACGGCCTGAGAGGCTACGAGACGCTACCG
GATTGGGTGTCCCCCGGCCAGGAGCCTGACGCCAAGCTACGCGATGGGCAGAACCAGGGGGGCGGTGCCTTTGTC
GGCTTCGTCTGCGGCGCCGAATGGGTTGGGTGA
Gene >Ophun1|1802
ATGTCCGCCAACGCACGTGACCAACCCAACACCCACCGGCCACCGGCGAAGCTTCCTCCCGCCCCCAAGCCCTTC
TCTTCGCAGCCTTCGCCCAAAGCTGGCATGGAGTCAGTATCCCGGATCTCGGGCCTCATGGAGACGGGTAAGAGC
AGGACCATCGTTTGCGCTGGCTGCCACGACTTCGACTTACCTCGCGCCGCCAGCGAGAGAGCTGACGCTCGATGC
CGCACAAGCCACGCGCGGCGCTCGCGTTGGCGCCCGTTCGCTCGATCGAGGCCAGATGAAGAAGCTTCTCGACAG
TAGGAATGATCGCGAAGTTCTCGACGGCTTGCGGCGCGTTGTCTCTGTTGGTCCTGTGTTGCTGTTTGTCTGGCT
GCGTCTGCTGATGGGATTTTCGCAGATGATGTATCGCAATCAGAAGACGCTGCCTTTTTTCTCGTCCGTCGTCAA
AAACGTCGCCTCTCCCAATCTCGAGATCAAGAAGCTTGTTTACATCTATCTCATCCACCATGCCGAGCACGAACC
CGACCTCGCCCTTCTCTCCATCAACACCATACAGAAATCGCTGTCCGACCCCAACCCCCAGGTCCGCGCCCTGGC
CCTAAAGACCATGTCCGGCATCCGCGTACCCGTCATCAGCCAGATCGTCGCCCTGGCCATCAGAAAGGGCGTCGC
AGACATGAGTCCCTACGTACGGAAAGCAGCTGCTCTCGCCATCCCCAAGTGTTACCGTCTCGATCCCGCCCAGTC
GCCACAACTCACCGACTGCCTTGCCACCCTCCTCGGCGACAGGCAGTTTTACGTTGCCGGTGCCGCCGTCTCGGC
TTTTCTGGAGATATGCCCTAGTCGCATCGACCTGATACATAAGCACTATCGGGGTCTGCTGCGCAAGGTCGTCGA
CATGGACGAATGGAGTCAGCTGGCTCTCCTGCGTCTCATGACATATTACGCGCGGAGGTGTTTTCCCCGGAGGAC
TCGGCCGTCGGGCTCGTCGCATGATTCGCGGTCAGCCGAGCGAGGAAACGGCATCGACGACTTCTACGGCGAGTC
GCCAGCTACACCATCCGCCAGCCACGGCCCCGGCGTCGTCGCCTCCTTGGATCCAGATCTGGTGCTCCTCCTCAA
CTCCATCAGGCCGTTGCTCCAGAGCCGCAACTCGGGCGTCGTCATGGCGGTCACGCGCTGCTACGTCGACGTCGG
TACGCCCGAATACGTCAAGCTCGCCGTCGGCCCGCTCGTCGCCCTCCTCCGAGCGGCGCAGGACATCCAGCAAAT
CGCCCTCTATAACATCGTCTCCGTCTGTCTTGCTCATCCTGGCGACTTTGTCAAGTACGCGAGCCACTTCCTCGT
CCGGGCCACGGACGCTCCCCCCGTCTGGGAGCTCAAGCTCGAGGTGCTCACCATCATCTTCCCTCACGGCTCGCC
CCACGTCAAGAGCCTCATCCTCAAGGAGCTTGAGCACTTTTCACGCGGCTCTAGCAAGGCCCTGGTTCGCGAGGC
CGTCCGCGCCATTGGCCGTTGTGCCCAGTCGGACGCCGCCACGGCACCCCGTTGCTTGAAGCTGCTTCTCGGCCA
GATCTCCAGCCTCGACGGCACCCTCGCGGCCGAGTCTCTTACGGTGATTCGCCATCTGATTCAGCAGGATTCCGA
GGCGCACGTCGGCACCGTCGTCAGGCTCGCCAAGAATCTCGACTCTGCGACGGATCCGCAGGCCAGAGCCACCAT
CATCTGGCTCGTTGGCGAGTTCTCGGGTCTGAATGGCGAGGACAACATCGCGCCGGATGTTCTCCGCATCCTCGT
CAGGGACTTTGCCAGCGAGTCGGAGCCAGCGAAGCGGCAAATCCTACTCCTCGCTGCTAAAGTCTACCTCCACCA
CCTCAACCGCTCCGCCGCTGCCACCGAGGAGGAAGCAGACAAGCAGACAGATGCTCTAGAAAGCGAGTATCTCCC
TCCACCCCGAGACGAGACGCAGCCGCACCCCATTCCGCGGCTGTGGGAGTACGTCCTCCTCCTCGTCCGCTACGA
CAGCTCCTACGACCTCCGCGACCGAGCAAGGATGTACCGCTCTCTCCTCGGCGTCCCCCAGCTCGCAACGCTCAT
GCTCCTGGCGCCCAAGCCAGCCCCCCAAGCGCCCAGCCCATCCGAGTCCCGCCGCGGCTTCCCCCTAGGATCCTC
AACGCTCGTCCTCGCCGACGCGGTCGGCGTCCACGGCCTGAGAGGCTACGAGACGCTACCGGATTGGGTGTCCCC
CGGCCAGGAGCCTGACGCCAAGCTACGCGATGGGCAGAACCAGGGGGTTGAGGGCGGCGGTGCGTTGCGAGCTGT
TTCCGCGAGTGATAGGCTTGACGATGCGAGTAGGGCGGTGCCTTTGTCGGCTTCGTCTGCGGCGCCGAATGGGTT
GGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail