Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1800
Gene name
LocationContig_18:3198..4645
Strand+
Gene length (bp)1447
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03800 Nuf2 Nuf2 family 1.7E-42 27 167
PF18595 Nuf2_DHR10-like Nuf2, DHR10-like domain 1.1E-34 280 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9H0|NUF2_NEUCR Probable kinetochore protein nuf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-2 PE=3 SV=1 1 461 0.0E+00
sp|Q4WVA0|NUF2_ASPFU Probable kinetochore protein nuf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nuf2 PE=3 SV=3 1 461 0.0E+00
sp|Q5BH14|NUF2_EMENI Probable kinetochore protein nuf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nuf2 PE=3 SV=2 1 461 0.0E+00
sp|Q2UEA0|NUF2_ASPOR Probable kinetochore protein nuf2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nuf2 PE=3 SV=1 1 461 0.0E+00
sp|Q4IBX0|NUF2_GIBZE Probable kinetochore protein NUF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NUF2 PE=3 SV=1 1 462 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9H0|NUF2_NEUCR Probable kinetochore protein nuf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-2 PE=3 SV=1 1 461 0.0E+00
sp|Q4WVA0|NUF2_ASPFU Probable kinetochore protein nuf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nuf2 PE=3 SV=3 1 461 0.0E+00
sp|Q5BH14|NUF2_EMENI Probable kinetochore protein nuf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nuf2 PE=3 SV=2 1 461 0.0E+00
sp|Q2UEA0|NUF2_ASPOR Probable kinetochore protein nuf2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nuf2 PE=3 SV=1 1 461 0.0E+00
sp|Q4IBX0|NUF2_GIBZE Probable kinetochore protein NUF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NUF2 PE=3 SV=1 1 462 0.0E+00
sp|Q10173|NUF2_SCHPO Kinetochore protein nuf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nuf2 PE=1 SV=1 28 457 3.0E-42
sp|Q6BPA9|NUF2_DEBHA Probable kinetochore protein NUF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NUF2 PE=3 SV=2 120 461 8.0E-28
sp|P0CP40|NUF2_CRYNJ Probable kinetochore protein NUF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NUF2 PE=3 SV=1 13 332 4.0E-19
sp|P0CP41|NUF2_CRYNB Probable kinetochore protein NUF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NUF2 PE=3 SV=1 13 332 5.0E-19
sp|Q6C3V4|NUF2_YARLI Probable kinetochore protein NUF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NUF2 PE=3 SV=1 1 457 1.0E-18
sp|Q5A1Q5|NUF2_CANAL Probable kinetochore protein NUF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUF2 PE=3 SV=2 11 461 1.0E-16
sp|Q7ZW63|NUF2_DANRE Kinetochore protein Nuf2 OS=Danio rerio GN=nuf2 PE=2 SV=1 47 443 5.0E-15
sp|Q6CJ06|NUF2_KLULA Probable kinetochore protein NUF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NUF2 PE=3 SV=1 27 457 2.0E-14
sp|Q757M3|NUF2_ASHGO Probable kinetochore protein NUF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NUF2 PE=3 SV=1 27 462 6.0E-12
sp|P33895|NUF2_YEAST Kinetochore protein NUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUF2 PE=1 SV=1 27 457 1.0E-10
sp|Q6FNH8|NUF2_CANGA Probable kinetochore protein NUF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NUF2 PE=3 SV=1 27 457 2.0E-08
sp|Q6GQ71|NUF2B_XENLA Kinetochore protein Nuf2-B OS=Xenopus laevis GN=nuf2-b PE=2 SV=2 47 327 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0031262 Ndc80 complex Yes
GO:0000776 kinetochore Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0043226 organelle No
GO:0099080 supramolecular complex No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1966
Ophiocordyceps australis map64 (Brazil) OphauB2|4605
Ophiocordyceps camponoti-floridani Ophcf2|02896
Ophiocordyceps camponoti-rufipedis Ophun1|1800 (this protein)
Ophiocordyceps kimflemingae Ophio5|5839
Ophiocordyceps subramaniannii Hirsu2|5996
Ophiocordyceps subramaniannii Hirsu2|6515

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1800
MAYNPRMSIAPSSQQNRTRSKKEDDPDAFMRLSDREIVGCITDIGINFSVADLQKPNATHVQQIFEWFAELLLNA
TRETVEAPMRAAAEDVCGDYADLVPVETRNLMGFYVSLRRLLVECGVYDFSFNDLYKPTYERLVKIFSYLINFVR
FRESQTSVIDEHFNKTESVKSRIETLHSENEEHDAQLEAMRRNRKAMEAQVREKTMRNEDLKRRLLELRRNQEKV
AARLDEAKVKKGQLTSQLEQKTQEKLTLRQESAKLRPYMLQSPSALQDNLSELREMLNNDKARIDALDRRARALQ
TSADSFAMVSTDVASCIKVLEDIAAELAKEEEEMARNARQRDALSERGNNAREVERAETMLRRQLSKWTERTEKL
RDQSNQKAQEAKEKMHGLRALHKKLTEEHTDKTKEMEIRRVRIEQTEKKMLDLKENIENEVHAAHDEYLKMEAHI
KLYITEMEQTIG*
Coding >Ophun1|1800
ATGGCGTACAACCCGAGGATGAGTATAGCCCCTTCGTCGCAGCAGAATCGAACGCGCAGCAAAAAGGAAGATGAC
CCAGACGCGTTCATGCGGCTCTCTGACCGCGAGATCGTCGGCTGCATCACGGACATTGGCATCAACTTCTCGGTT
GCGGACCTGCAGAAGCCCAACGCGACGCACGTACAGCAAATCTTTGAATGGTTCGCTGAGCTGCTTCTCAACGCG
ACGCGCGAGACGGTCGAGGCTCCGATGCGGGCGGCGGCCGAGGACGTGTGCGGCGACTATGCCGACCTGGTGCCG
GTCGAGACGCGAAATCTGATGGGCTTCTACGTGTCGCTGCGGCGGCTACTCGTCGAGTGCGGCGTCTACGACTTC
AGCTTCAACGACCTGTACAAGCCGACGTACGAGCGGCTGGTCAAGATCTTTAGCTATCTCATCAACTTTGTGCGA
TTTCGGGAGTCGCAGACGTCGGTCATCGATGAGCACTTCAACAAGACGGAGTCGGTGAAATCGCGCATAGAAACG
CTTCACTCGGAGAACGAAGAGCACGACGCGCAGTTGGAGGCGATGCGGCGGAACCGCAAGGCAATGGAGGCTCAG
GTGCGGGAGAAGACGATGCGCAACGAGGACCTCAAGCGACGCCTTCTCGAGCTGCGGCGCAACCAGGAGAAGGTG
GCGGCGCGGCTGGACGAGGCCAAGGTGAAAAAGGGCCAACTGACGAGCCAGCTGGAGCAAAAGACGCAGGAGAAG
CTTACGCTGCGGCAAGAGAGTGCCAAGCTGCGTCCGTACATGCTGCAGAGTCCATCGGCGTTGCAGGATAACCTC
TCTGAGCTGCGCGAGATGCTCAACAACGACAAGGCGCGCATCGACGCGCTGGATCGACGCGCCCGCGCGTTGCAG
ACGTCGGCCGACTCGTTCGCCATGGTATCGACGGACGTGGCGTCTTGCATCAAGGTCCTCGAAGATATCGCCGCC
GAGCTGGCAAAGGAAGAGGAGGAGATGGCGCGCAACGCGAGACAGCGCGATGCCCTCTCGGAACGGGGCAACAAT
GCGCGAGAGGTTGAGCGGGCAGAGACGATGCTGCGCCGCCAGCTGAGCAAGTGGACGGAGCGGACGGAGAAGCTG
CGTGACCAGAGCAATCAGAAGGCTCAGGAGGCCAAGGAGAAGATGCATGGCTTGCGTGCTCTGCACAAGAAGTTG
ACGGAGGAGCACACGGATAAGACCAAGGAGATGGAGATTCGGAGGGTGAGGATCGAGCAGACGGAGAAGAAGATG
TTGGACCTCAAGGAGAACATCGAGAACGAGGTGCATGCCGCGCACGACGAGTATCTGAAGATGGAGGCGCACATC
AAGCTGTACATCACGGAGATGGAGCAGACCATTGGATAG
Transcript >Ophun1|1800
ATGGCGTACAACCCGAGGATGAGTATAGCCCCTTCGTCGCAGCAGAATCGAACGCGCAGCAAAAAGGAAGATGAC
CCAGACGCGTTCATGCGGCTCTCTGACCGCGAGATCGTCGGCTGCATCACGGACATTGGCATCAACTTCTCGGTT
GCGGACCTGCAGAAGCCCAACGCGACGCACGTACAGCAAATCTTTGAATGGTTCGCTGAGCTGCTTCTCAACGCG
ACGCGCGAGACGGTCGAGGCTCCGATGCGGGCGGCGGCCGAGGACGTGTGCGGCGACTATGCCGACCTGGTGCCG
GTCGAGACGCGAAATCTGATGGGCTTCTACGTGTCGCTGCGGCGGCTACTCGTCGAGTGCGGCGTCTACGACTTC
AGCTTCAACGACCTGTACAAGCCGACGTACGAGCGGCTGGTCAAGATCTTTAGCTATCTCATCAACTTTGTGCGA
TTTCGGGAGTCGCAGACGTCGGTCATCGATGAGCACTTCAACAAGACGGAGTCGGTGAAATCGCGCATAGAAACG
CTTCACTCGGAGAACGAAGAGCACGACGCGCAGTTGGAGGCGATGCGGCGGAACCGCAAGGCAATGGAGGCTCAG
GTGCGGGAGAAGACGATGCGCAACGAGGACCTCAAGCGACGCCTTCTCGAGCTGCGGCGCAACCAGGAGAAGGTG
GCGGCGCGGCTGGACGAGGCCAAGGTGAAAAAGGGCCAACTGACGAGCCAGCTGGAGCAAAAGACGCAGGAGAAG
CTTACGCTGCGGCAAGAGAGTGCCAAGCTGCGTCCGTACATGCTGCAGAGTCCATCGGCGTTGCAGGATAACCTC
TCTGAGCTGCGCGAGATGCTCAACAACGACAAGGCGCGCATCGACGCGCTGGATCGACGCGCCCGCGCGTTGCAG
ACGTCGGCCGACTCGTTCGCCATGGTATCGACGGACGTGGCGTCTTGCATCAAGGTCCTCGAAGATATCGCCGCC
GAGCTGGCAAAGGAAGAGGAGGAGATGGCGCGCAACGCGAGACAGCGCGATGCCCTCTCGGAACGGGGCAACAAT
GCGCGAGAGGTTGAGCGGGCAGAGACGATGCTGCGCCGCCAGCTGAGCAAGTGGACGGAGCGGACGGAGAAGCTG
CGTGACCAGAGCAATCAGAAGGCTCAGGAGGCCAAGGAGAAGATGCATGGCTTGCGTGCTCTGCACAAGAAGTTG
ACGGAGGAGCACACGGATAAGACCAAGGAGATGGAGATTCGGAGGGTGAGGATCGAGCAGACGGAGAAGAAGATG
TTGGACCTCAAGGAGAACATCGAGAACGAGGTGCATGCCGCGCACGACGAGTATCTGAAGATGGAGGCGCACATC
AAGCTGTACATCACGGAGATGGAGCAGACCATTGGATAG
Gene >Ophun1|1800
ATGGCGTACAACCCGAGGATGAGTATAGCCCCTTCGTCGCAGCAGAATCGAACGCGCAGCAAAAAGGAAGATGAC
CCAGACGCGTTCATGCGGCTCTCTGACCGCGAGATCGTCGGCTGCATCACGGACATTGGCATCAACTTCTCGGTT
GCGGACCTGCAGAAGCCCAACGCGACGCACGTACAGCAAATCTTTGAATGGTTCGCTGAGCTGCTTCTCAACGCG
ACGCGCGAGACGGTCGAGGCTCCGATGCGGGCGGCGGCCGAGGACGTGTGCGGCGACTATGCCGACCTGGTGCCG
GTCGAGACGCGAAATCTGATGGGCTTCTACGTGTCGCTGCGGCGGCTACTCGTCGAGTGCGGCGTCTACGACTTC
AGCTTCAACGACCTGTACAAGCCGACGTACGAGCGGCTGGTCAAGATCTTTAGCTATCTCATCAACTTTGTGCGA
TTTCGGGAGTCGCAGACGTCGGTCATCGATGAGCACTTCAACAAGACGGAGTCGGTGAAATCGCGCATAGAAACG
CTTCACTCGGAGAACGAAGAGCACGACGCGCAGTTGGAGGCGATGCGGCGGAACCGCAAGGCAATGGAGGCTCAG
GTGCGGGAGAAGACGATGCGCAACGAGGACCTCAAGCGACGCCTTCTCGAGCTGCGGCGCAACCAGGAGAAGGTG
GCGGCGCGGCTGGACGAGGCCAAGGTGAAAAAGGGCCAACTGACGAGCCAGCTGGAGCAAAAGACGCAGGAGAAG
CTTACGCTGCGGCAAGAGAGTGCCAAGCTGCGTCCGTACATGCTGCAGAGTCCATCGGCGTTGCAGGATAACCTC
TCTGAGCTGCGCGAGATGCTCAACAACGACAAGGCGCGCATCGACGCGCTGGATCGACGCGCCCGCGCGTTGCAG
ACGTCGGCCGACTCGTTCGCCATGGTATCGACGGACGTGGCGTCTTGCATCAAGGTCCTCGAAGATATCGCCGCC
GAGCTGGCAAAGGAAGAGGAGGAGATGGCGCGCAACGCGAGACAGCGCGATGCCCTCTCGGAACGGGGCAACAAT
GCGCGAGAGGTTGAGCGGGCAGAGACGATGCTGCGCCGCCAGCTGAGCAAGTGGACGGAGCGGACGGAGAAGCTG
CGTGACCAGAGCAATCAGAAGGCTCAGGAGGCCAAGGAGAAGATGCATGGCTTGCGTGCTCTGCACAAGAAGTTG
ACGGAGGAGCACACGGATAAGACCAAGGAGATGGAGATTCGGAGGGTGAGGATCGAGCAGACGGAGAAGAAGGTG
TGTTTTGCTCCCATCGTGTCATCACTGGGTTACGTTGATGTGCTGACTGGAGTAGATGTTGGACCTCAAGGAGAA
CATCGAGAACGAGGTGCATGCCGCGCACGACGAGTATCTGAAGATGGAGGCGCACATCAAGCTGTACATCACGGA
GATGGAGCAGACCATTGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail