Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1796
Gene name
LocationContig_179:28392..29846
Strand+
Gene length (bp)1454
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 2.0E-07 1 37

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38966|YD089_YEAST Uncharacterized protein YDR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR089W PE=1 SV=2 1 180 6.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 366 388 22
2 400 422 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1796
MKFGQQLERESIPEWRLHNLDYNSLKHEIKAHTSTLHATPTAIPGHPDLALCKFEDGLYIELEQQHNRLDLFVSS
KADEISRRLDHLDSHVHRWLRKHADEVDASLSLRRQRKLAKYERELLRCGRDILHLSRFSNAQVIAFRKILKKYR
KWTGSVSLTARFNQTILSNPKSFTRRDWDPLQTRHDEILADVRSASSIYSEPSSPSTDSHSHLDRPPSRTPRVKF
DPLPPLRFQPLVSQYWNEYDDGSDAGVGPDDDAEYAIYVHPDDRSSPFPGLSYVRALTTIPYEKAKQWLNRHTQP
TDPLLQPQDPEANYGTCPQPSAPPASHDKLLARSTAASLVASLSLTSLSTALLTSRRARLRLETDALVTAAVLVS
LVCACGGLGLTLVRDTRPGLLHRALVCGAFVAACLWSGVLLVLVIGSAP*
Coding >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCATAACCTCGACTACAACTCGCTC
AAGCACGAGATCAAAGCCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCC
CTGTGCAAGTTCGAAGACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGC
AAGGCAGATGAGATTTCCAGACGGCTGGATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGAT
GAAGTCGACGCCTCCCTCTCACTCCGCCGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGC
CGCGACATCCTCCATCTCTCACGCTTCTCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGC
AAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCATCCTCAGCAATCCAAAGAGCTTCACCCGC
CGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCGACGTCCGCTCCGCCTCCTCCATCTACAGC
GAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCCCTCCATCTCGCACTCCGCGGGTCAAATTC
GATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACTGGAACGAGTATGACGATGGCAGTGACGCC
GGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATCCCGACGACCGCTCCTCCCCCTTCCCCGGC
CTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCAAGCAATGGCTCAACCGCCACACCCAACCC
ACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCACCTGCCCCCAACCATCCGCCCCCCCGGCC
TCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCGCCTCCCTCAGCCTAACCAGCCTCTCCACC
GCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACGCCCTGGTCACCGCCGCCGTCCTCGTCAGC
CTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATACGAGGCCCGGCTTGCTCCATAGGGCTCTT
GTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGCTTGTCTTGGTGATTGGGAGTGCGCCTTAG
Transcript >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCATAACCTCGACTACAACTCGCTC
AAGCACGAGATCAAAGCCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCC
CTGTGCAAGTTCGAAGACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGC
AAGGCAGATGAGATTTCCAGACGGCTGGATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGAT
GAAGTCGACGCCTCCCTCTCACTCCGCCGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGC
CGCGACATCCTCCATCTCTCACGCTTCTCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGC
AAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCATCCTCAGCAATCCAAAGAGCTTCACCCGC
CGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCGACGTCCGCTCCGCCTCCTCCATCTACAGC
GAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCCCTCCATCTCGCACTCCGCGGGTCAAATTC
GATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACTGGAACGAGTATGACGATGGCAGTGACGCC
GGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATCCCGACGACCGCTCCTCCCCCTTCCCCGGC
CTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCAAGCAATGGCTCAACCGCCACACCCAACCC
ACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCACCTGCCCCCAACCATCCGCCCCCCCGGCC
TCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCGCCTCCCTCAGCCTAACCAGCCTCTCCACC
GCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACGCCCTGGTCACCGCCGCCGTCCTCGTCAGC
CTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATACGAGGCCCGGCTTGCTCCATAGGGCTCTT
GTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGCTTGTCTTGGTGATTGGGAGTGCGCCTTAG
Gene >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCGTCAGTATACAACAGACCTTGTC
TCTCTCACAGTCAATTACTGACGGACGATCCCACAGATAACCTCGACTACAACTCGCTCAAGCACGAGATCAAAG
CCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCCCTGTGCAAGTTCGAAG
ACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGCAAGGCAGATGAGATTT
CCAGACGGCTGGGTAACGGCTTTTCCTTGACACCGCTACTGAAGGTAACCTCTTGCTGAAACTTGCCCACCAACA
GATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGATGAAGTCGACGCCTCCCTCTCACTCCGC
CGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGCCGCGACATCCTCCATCTCTCACGCTTC
TCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGCGTACGCTCCCTCCCTCTCCCCTCTCAC
CCTCCCAACCCAACACTCACACCGCCTAGAAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCA
TCCTCAGCAATCCAAAGAGCTTCACCCGCCGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCG
ACGTCCGCTCCGCCTCCTCCATCTACAGCGAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCC
CTCCATCTCGCACTCCGCGGGTCAAATTCGATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACT
GGAACGAGTATGACGATGGCAGTGACGCCGGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATC
CCGACGACCGCTCCTCCCCCTTCCCCGGCCTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCA
AGCAATGGCTCAACCGCCACACCCAACCCACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCA
CCTGCCCCCAACCATCCGCCCCCCCGGCCTCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCG
CCTCCCTCAGCCTAACCAGCCTCTCCACCGCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACG
CCCTGGTCACCGCCGCCGTCCTCGTCAGCCTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATA
CGAGGCCCGGCTTGCTCCATAGGGCTCTTGTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGC
TTGTCTTGGTGATTGGGAGTGCGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail