Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1796
Gene name
LocationContig_179:28392..29846
Strand+
Gene length (bp)1454
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 2.0E-07 1 37

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38966|YD089_YEAST Uncharacterized protein YDR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR089W PE=1 SV=2 1 180 6.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 366 388 22
2 400 422 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2775
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4412
Ophiocordyceps australis map64 (Brazil) OphauB2|5268
Ophiocordyceps camponoti-floridani Ophcf2|02099
Ophiocordyceps camponoti-rufipedis Ophun1|1796 (this protein)
Ophiocordyceps kimflemingae Ophio5|502
Ophiocordyceps subramaniannii Hirsu2|4420

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1796
MKFGQQLERESIPEWRLHNLDYNSLKHEIKAHTSTLHATPTAIPGHPDLALCKFEDGLYIELEQQHNRLDLFVSS
KADEISRRLDHLDSHVHRWLRKHADEVDASLSLRRQRKLAKYERELLRCGRDILHLSRFSNAQVIAFRKILKKYR
KWTGSVSLTARFNQTILSNPKSFTRRDWDPLQTRHDEILADVRSASSIYSEPSSPSTDSHSHLDRPPSRTPRVKF
DPLPPLRFQPLVSQYWNEYDDGSDAGVGPDDDAEYAIYVHPDDRSSPFPGLSYVRALTTIPYEKAKQWLNRHTQP
TDPLLQPQDPEANYGTCPQPSAPPASHDKLLARSTAASLVASLSLTSLSTALLTSRRARLRLETDALVTAAVLVS
LVCACGGLGLTLVRDTRPGLLHRALVCGAFVAACLWSGVLLVLVIGSAP*
Coding >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCATAACCTCGACTACAACTCGCTC
AAGCACGAGATCAAAGCCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCC
CTGTGCAAGTTCGAAGACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGC
AAGGCAGATGAGATTTCCAGACGGCTGGATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGAT
GAAGTCGACGCCTCCCTCTCACTCCGCCGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGC
CGCGACATCCTCCATCTCTCACGCTTCTCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGC
AAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCATCCTCAGCAATCCAAAGAGCTTCACCCGC
CGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCGACGTCCGCTCCGCCTCCTCCATCTACAGC
GAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCCCTCCATCTCGCACTCCGCGGGTCAAATTC
GATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACTGGAACGAGTATGACGATGGCAGTGACGCC
GGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATCCCGACGACCGCTCCTCCCCCTTCCCCGGC
CTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCAAGCAATGGCTCAACCGCCACACCCAACCC
ACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCACCTGCCCCCAACCATCCGCCCCCCCGGCC
TCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCGCCTCCCTCAGCCTAACCAGCCTCTCCACC
GCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACGCCCTGGTCACCGCCGCCGTCCTCGTCAGC
CTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATACGAGGCCCGGCTTGCTCCATAGGGCTCTT
GTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGCTTGTCTTGGTGATTGGGAGTGCGCCTTAG
Transcript >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCATAACCTCGACTACAACTCGCTC
AAGCACGAGATCAAAGCCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCC
CTGTGCAAGTTCGAAGACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGC
AAGGCAGATGAGATTTCCAGACGGCTGGATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGAT
GAAGTCGACGCCTCCCTCTCACTCCGCCGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGC
CGCGACATCCTCCATCTCTCACGCTTCTCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGC
AAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCATCCTCAGCAATCCAAAGAGCTTCACCCGC
CGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCGACGTCCGCTCCGCCTCCTCCATCTACAGC
GAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCCCTCCATCTCGCACTCCGCGGGTCAAATTC
GATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACTGGAACGAGTATGACGATGGCAGTGACGCC
GGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATCCCGACGACCGCTCCTCCCCCTTCCCCGGC
CTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCAAGCAATGGCTCAACCGCCACACCCAACCC
ACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCACCTGCCCCCAACCATCCGCCCCCCCGGCC
TCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCGCCTCCCTCAGCCTAACCAGCCTCTCCACC
GCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACGCCCTGGTCACCGCCGCCGTCCTCGTCAGC
CTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATACGAGGCCCGGCTTGCTCCATAGGGCTCTT
GTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGCTTGTCTTGGTGATTGGGAGTGCGCCTTAG
Gene >Ophun1|1796
ATGAAATTCGGCCAACAGCTTGAACGCGAGTCCATCCCCGAATGGCGGCTCCGTCAGTATACAACAGACCTTGTC
TCTCTCACAGTCAATTACTGACGGACGATCCCACAGATAACCTCGACTACAACTCGCTCAAGCACGAGATCAAAG
CCCACACCTCAACCCTCCACGCCACCCCGACCGCCATCCCCGGCCACCCGGATCTCGCCCTGTGCAAGTTCGAAG
ACGGGCTTTACATTGAGCTCGAGCAGCAGCACAATCGCCTGGATCTCTTCGTCAGCAGCAAGGCAGATGAGATTT
CCAGACGGCTGGGTAACGGCTTTTCCTTGACACCGCTACTGAAGGTAACCTCTTGCTGAAACTTGCCCACCAACA
GATCACCTCGACTCCCATGTTCACCGCTGGCTACGAAAACATGCCGATGAAGTCGACGCCTCCCTCTCACTCCGC
CGCCAACGAAAACTGGCAAAGTACGAGCGCGAGCTTCTCCGCTGCGGCCGCGACATCCTCCATCTCTCACGCTTC
TCAAACGCCCAGGTCATTGCCTTTCGCAAGATCCTCAAGAAATACCGCGTACGCTCCCTCCCTCTCCCCTCTCAC
CCTCCCAACCCAACACTCACACCGCCTAGAAATGGACCGGCTCCGTCTCCCTGACAGCCCGCTTCAACCAAACCA
TCCTCAGCAATCCAAAGAGCTTCACCCGCCGCGACTGGGACCCCCTGCAGACGCGCCACGATGAGATCCTCGCCG
ACGTCCGCTCCGCCTCCTCCATCTACAGCGAGCCAAGTTCGCCGTCGACAGACTCCCACTCGCACCTCGATCGCC
CTCCATCTCGCACTCCGCGGGTCAAATTCGATCCTCTCCCGCCCCTTCGCTTCCAACCCCTGGTCAGCCAGTACT
GGAACGAGTATGACGATGGCAGTGACGCCGGCGTCGGACCCGATGATGACGCAGAGTACGCCATCTACGTCCATC
CCGACGACCGCTCCTCCCCCTTCCCCGGCCTATCCTACGTCCGCGCCCTCACAACGATCCCCTACGAGAAAGCCA
AGCAATGGCTCAACCGCCACACCCAACCCACGGACCCCCTCCTCCAACCTCAAGACCCGGAAGCCAACTACGGCA
CCTGCCCCCAACCATCCGCCCCCCCGGCCTCCCACGACAAGCTCCTCGCCCGCAGCACAGCAGCCAGCCTCGTCG
CCTCCCTCAGCCTAACCAGCCTCTCCACCGCCCTGCTCACCAGCCGCCGCGCCCGCCTCCGCCTCGAGACGGACG
CCCTGGTCACCGCCGCCGTCCTCGTCAGCCTCGTCTGCGCCTGCGGCGGTCTGGGACTCACCCTCGTGCGCGATA
CGAGGCCCGGCTTGCTCCATAGGGCTCTTGTTTGCGGTGCCTTTGTCGCGGCTTGTCTTTGGAGTGGGGTTTTGC
TTGTCTTGGTGATTGGGAGTGCGCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail