Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1793
Gene name
LocationContig_179:21959..24480
Strand-
Gene length (bp)2521
Transcript length (bp)2469
Coding sequence length (bp)2469
Protein length (aa) 823

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 3.2E-210 87 617
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 2.0E-53 645 821

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 87 805 8.0E-139
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 87 821 5.0E-133
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 87 821 5.0E-131
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 80 822 8.0E-131
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 80 822 5.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 87 805 8.0E-139
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 87 821 5.0E-133
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 87 821 5.0E-131
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 80 822 8.0E-131
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 80 822 5.0E-129
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 82 822 2.0E-128
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 75 821 3.0E-126
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 17 803 4.0E-124
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 84 822 5.0E-119
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 80 818 5.0E-98
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 316 821 9.0E-81
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 89 821 3.0E-79
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 87 322 7.0E-48
sp|P0C7U1|ASA2B_HUMAN Putative inactive neutral ceramidase B OS=Homo sapiens GN=ASAH2B PE=2 SV=1 663 821 5.0E-15
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup74
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|149
Ophiocordyceps australis 1348a (Ghana) OphauG2|4414
Ophiocordyceps australis 1348a (Ghana) OphauG2|5649
Ophiocordyceps australis map64 (Brazil) OphauB2|502
Ophiocordyceps australis map64 (Brazil) OphauB2|5266
Ophiocordyceps australis map64 (Brazil) OphauB2|7887
Ophiocordyceps camponoti-floridani Ophcf2|01033
Ophiocordyceps camponoti-floridani Ophcf2|01218
Ophiocordyceps camponoti-floridani Ophcf2|02102
Ophiocordyceps camponoti-rufipedis Ophun1|1793 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6086
Ophiocordyceps kimflemingae Ophio5|1151
Ophiocordyceps kimflemingae Ophio5|2727
Ophiocordyceps kimflemingae Ophio5|723
Ophiocordyceps subramaniannii Hirsu2|3661
Ophiocordyceps subramaniannii Hirsu2|7981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1793
MMADARHGGNDESMLRRRRFRLSLSLLVPLLAAAAAVLALSRASGWTGLPPRLSSSPLHLNGPDAGDNGWAGLQL
PEAEAGAGDGLYLLGVGKADITGPVVELNLMGYADFTQMGSGLRQRLYSRAFIVGDVARPLDRFVYLVLDIQSGD
TAVRYGVLRGLSRLGPRYSMYRHDNVAVTATHSHSGPGAWLNYLLPQIPSRGFDRQSFQAIVDGCLLSIRRAHES
LAPGELTVGSTKLVGAGINRSLFSYMANPEAERARYNISAQDDGSVDTDMTMLSFRRASDRRNIGLLTWFPTHGT
SMQANNTLISGDNKGVAADMLEKALRDDDATDSDFVAGFSQANMGDVSPNVLGAWCQDGSGQRCRLEDSTCADGR
GSLCRARGPGRTTDDHGASSCLEIGRRQFRAALDLYRRLDRQPANVRGEGVKAFHRFHDMAGFSFRLPNGSEAVT
CAAALGYSFGAGTWDEPGSFDLVQHLSAKSKSSFLWPLISWLIRHPTPEQSRCQEPKTILLDVGDKGFPYAWTPN
VVDVQTLRVGQLLVIVSPGEATTMAGRRWKQAVADEARKTLADELEGREPVVVLGAPSNSYTHYITTEEEYGVQR
YEGASTLYGRHTLAAHMDRSVASVAYLRSSLLPSSPPPDRVFLPQPEPPDNSNRSWSLIAGVVYDRAGRNRRFGD
VTVDVKRKHFQRGDVVSATFVGANPRNNLRLEQTYAAVERRQTSPALQTRWKVALSSGGHQALLSSPPGGGGGTS
SWRTIRDDSDWALTFHWRRKSALLGTSEVRVEWEVEDDVPPGEYRLRYFGDYKSLGGRIEGFEGMSGTFYVE*
Coding >Ophun1|1793
ATGATGGCGGACGCACGCCACGGCGGCAATGACGAGTCGATGCTGCGTCGACGCCGCTTCCGACTGTCCCTGTCC
CTGCTGGTCCCCCTCCTGGCCGCCGCTGCCGCCGTCTTGGCCCTCTCCCGGGCTTCCGGCTGGACCGGTCTCCCC
CCGAGGTTGTCGTCATCGCCCCTCCATCTCAACGGTCCCGACGCTGGCGACAACGGCTGGGCCGGCTTGCAGCTA
CCGGAGGCCGAGGCCGGTGCCGGCGATGGCTTGTATCTGCTGGGCGTCGGCAAGGCTGACATCACGGGCCCTGTT
GTCGAGCTCAATCTGATGGGGTATGCCGACTTTACCCAGATGGGCTCCGGCTTACGACAACGCCTGTACTCGCGC
GCCTTCATCGTCGGTGACGTGGCCCGACCCCTGGACCGCTTTGTCTACCTCGTTCTCGACATCCAGTCCGGTGAT
ACCGCCGTCCGGTACGGCGTCCTCCGGGGTCTCTCCCGGCTCGGGCCGCGTTACAGCATGTACCGCCATGACAAC
GTGGCCGTCACGGCGACACACTCTCACTCCGGGCCCGGTGCCTGGCTCAACTACTTGCTTCCGCAGATCCCCAGC
CGCGGCTTCGACCGCCAGAGCTTTCAAGCCATCGTCGACGGCTGTCTGCTGTCGATTCGTCGTGCTCACGAGAGC
CTGGCTCCCGGTGAGCTGACCGTCGGCTCTACCAAGCTCGTCGGCGCCGGCATCAACCGTAGTCTCTTCTCCTAC
ATGGCCAATCCCGAGGCCGAGCGGGCGCGGTACAACATCAGCGCTCAAGACGATGGTTCCGTCGATACTGACATG
ACCATGTTGTCTTTCCGTCGGGCCTCGGATCGTCGCAACATTGGCCTGCTGACATGGTTCCCTACCCACGGCACG
TCGATGCAGGCCAACAACACGCTCATCTCTGGCGATAACAAGGGTGTTGCTGCCGATATGCTCGAAAAGGCACTG
AGGGACGACGATGCTACCGACTCGGACTTTGTAGCCGGCTTCTCCCAGGCCAATATGGGCGACGTCAGTCCCAAT
GTCCTCGGCGCCTGGTGTCAGGACGGCTCTGGCCAGCGCTGTCGTCTCGAAGACAGCACCTGCGCCGACGGCCGG
GGAAGCCTGTGCCGCGCTCGGGGTCCGGGCCGGACGACGGACGATCACGGGGCCTCGTCGTGTCTCGAGATCGGA
CGGAGGCAGTTCCGGGCCGCCCTCGACTTATACCGTCGTCTGGACCGACAGCCGGCCAACGTCCGGGGCGAGGGC
GTCAAGGCCTTTCACCGCTTCCACGACATGGCTGGCTTCTCCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACC
TGCGCCGCTGCGCTGGGATACTCGTTCGGCGCCGGAACGTGGGACGAGCCGGGCTCGTTCGATCTTGTGCAGCAC
CTGTCGGCCAAGTCCAAGTCTTCGTTTCTGTGGCCTCTCATCAGTTGGCTGATCCGGCATCCGACGCCCGAGCAG
AGCCGCTGCCAAGAGCCCAAGACGATCCTGCTGGACGTGGGCGACAAGGGCTTCCCGTACGCGTGGACGCCCAAC
GTGGTCGATGTGCAGACGCTGCGAGTTGGCCAGCTGCTCGTCATTGTGAGCCCGGGAGAGGCTACCACCATGGCT
GGCAGGCGGTGGAAGCAAGCTGTCGCTGACGAGGCGAGGAAGACGCTGGCTGATGAGTTGGAGGGGAGGGAGCCG
GTTGTTGTGCTGGGAGCGCCGAGTAACAGTTATACTCATTACATCACGACGGAAGAGGAGTATGGCGTGCAGCGA
TATGAGGGCGCTTCGACCCTCTACGGACGGCATACGCTGGCGGCGCACATGGACCGCAGCGTGGCGTCCGTCGCC
TACCTCCGATCATCGTTATTGCCGTCCTCGCCGCCTCCAGACCGCGTCTTCCTCCCGCAGCCGGAGCCGCCGGAC
AACAGCAACCGGTCGTGGAGCCTGATCGCGGGCGTCGTCTACGATCGGGCCGGACGCAATCGACGCTTCGGCGAC
GTGACGGTCGATGTCAAACGCAAGCATTTCCAGAGAGGCGACGTCGTCTCCGCCACCTTTGTCGGCGCCAACCCG
CGCAACAACCTGCGGCTGGAGCAGACGTACGCGGCCGTCGAGAGGCGACAGACGTCTCCGGCGCTGCAGACTCGC
TGGAAAGTGGCTCTCTCCTCTGGCGGACACCAGGCCTTGCTGTCTTCTCCCCCCGGCGGAGGAGGAGGGACGTCA
TCGTGGCGGACGATCCGGGACGATTCCGACTGGGCGCTTACCTTTCACTGGCGGAGGAAGAGCGCGCTGCTGGGG
ACGAGCGAGGTGAGAGTCGAGTGGGAGGTTGAAGACGACGTGCCGCCCGGGGAGTACAGGCTGAGGTATTTTGGC
GATTACAAGTCTTTGGGGGGGAGGATAGAGGGGTTTGAGGGCATGAGCGGGACGTTTTATGTTGAGTGA
Transcript >Ophun1|1793
ATGATGGCGGACGCACGCCACGGCGGCAATGACGAGTCGATGCTGCGTCGACGCCGCTTCCGACTGTCCCTGTCC
CTGCTGGTCCCCCTCCTGGCCGCCGCTGCCGCCGTCTTGGCCCTCTCCCGGGCTTCCGGCTGGACCGGTCTCCCC
CCGAGGTTGTCGTCATCGCCCCTCCATCTCAACGGTCCCGACGCTGGCGACAACGGCTGGGCCGGCTTGCAGCTA
CCGGAGGCCGAGGCCGGTGCCGGCGATGGCTTGTATCTGCTGGGCGTCGGCAAGGCTGACATCACGGGCCCTGTT
GTCGAGCTCAATCTGATGGGGTATGCCGACTTTACCCAGATGGGCTCCGGCTTACGACAACGCCTGTACTCGCGC
GCCTTCATCGTCGGTGACGTGGCCCGACCCCTGGACCGCTTTGTCTACCTCGTTCTCGACATCCAGTCCGGTGAT
ACCGCCGTCCGGTACGGCGTCCTCCGGGGTCTCTCCCGGCTCGGGCCGCGTTACAGCATGTACCGCCATGACAAC
GTGGCCGTCACGGCGACACACTCTCACTCCGGGCCCGGTGCCTGGCTCAACTACTTGCTTCCGCAGATCCCCAGC
CGCGGCTTCGACCGCCAGAGCTTTCAAGCCATCGTCGACGGCTGTCTGCTGTCGATTCGTCGTGCTCACGAGAGC
CTGGCTCCCGGTGAGCTGACCGTCGGCTCTACCAAGCTCGTCGGCGCCGGCATCAACCGTAGTCTCTTCTCCTAC
ATGGCCAATCCCGAGGCCGAGCGGGCGCGGTACAACATCAGCGCTCAAGACGATGGTTCCGTCGATACTGACATG
ACCATGTTGTCTTTCCGTCGGGCCTCGGATCGTCGCAACATTGGCCTGCTGACATGGTTCCCTACCCACGGCACG
TCGATGCAGGCCAACAACACGCTCATCTCTGGCGATAACAAGGGTGTTGCTGCCGATATGCTCGAAAAGGCACTG
AGGGACGACGATGCTACCGACTCGGACTTTGTAGCCGGCTTCTCCCAGGCCAATATGGGCGACGTCAGTCCCAAT
GTCCTCGGCGCCTGGTGTCAGGACGGCTCTGGCCAGCGCTGTCGTCTCGAAGACAGCACCTGCGCCGACGGCCGG
GGAAGCCTGTGCCGCGCTCGGGGTCCGGGCCGGACGACGGACGATCACGGGGCCTCGTCGTGTCTCGAGATCGGA
CGGAGGCAGTTCCGGGCCGCCCTCGACTTATACCGTCGTCTGGACCGACAGCCGGCCAACGTCCGGGGCGAGGGC
GTCAAGGCCTTTCACCGCTTCCACGACATGGCTGGCTTCTCCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACC
TGCGCCGCTGCGCTGGGATACTCGTTCGGCGCCGGAACGTGGGACGAGCCGGGCTCGTTCGATCTTGTGCAGCAC
CTGTCGGCCAAGTCCAAGTCTTCGTTTCTGTGGCCTCTCATCAGTTGGCTGATCCGGCATCCGACGCCCGAGCAG
AGCCGCTGCCAAGAGCCCAAGACGATCCTGCTGGACGTGGGCGACAAGGGCTTCCCGTACGCGTGGACGCCCAAC
GTGGTCGATGTGCAGACGCTGCGAGTTGGCCAGCTGCTCGTCATTGTGAGCCCGGGAGAGGCTACCACCATGGCT
GGCAGGCGGTGGAAGCAAGCTGTCGCTGACGAGGCGAGGAAGACGCTGGCTGATGAGTTGGAGGGGAGGGAGCCG
GTTGTTGTGCTGGGAGCGCCGAGTAACAGTTATACTCATTACATCACGACGGAAGAGGAGTATGGCGTGCAGCGA
TATGAGGGCGCTTCGACCCTCTACGGACGGCATACGCTGGCGGCGCACATGGACCGCAGCGTGGCGTCCGTCGCC
TACCTCCGATCATCGTTATTGCCGTCCTCGCCGCCTCCAGACCGCGTCTTCCTCCCGCAGCCGGAGCCGCCGGAC
AACAGCAACCGGTCGTGGAGCCTGATCGCGGGCGTCGTCTACGATCGGGCCGGACGCAATCGACGCTTCGGCGAC
GTGACGGTCGATGTCAAACGCAAGCATTTCCAGAGAGGCGACGTCGTCTCCGCCACCTTTGTCGGCGCCAACCCG
CGCAACAACCTGCGGCTGGAGCAGACGTACGCGGCCGTCGAGAGGCGACAGACGTCTCCGGCGCTGCAGACTCGC
TGGAAAGTGGCTCTCTCCTCTGGCGGACACCAGGCCTTGCTGTCTTCTCCCCCCGGCGGAGGAGGAGGGACGTCA
TCGTGGCGGACGATCCGGGACGATTCCGACTGGGCGCTTACCTTTCACTGGCGGAGGAAGAGCGCGCTGCTGGGG
ACGAGCGAGGTGAGAGTCGAGTGGGAGGTTGAAGACGACGTGCCGCCCGGGGAGTACAGGCTGAGGTATTTTGGC
GATTACAAGTCTTTGGGGGGGAGGATAGAGGGGTTTGAGGGCATGAGCGGGACGTTTTATGTTGAGTGA
Gene >Ophun1|1793
ATGATGGCGGACGCACGCCACGGCGGCAATGACGAGTCGATGCTGCGTCGACGCCGCTTCCGACTGTCCCTGTCC
CTGCTGGTCCCCCTCCTGGCCGCCGCTGCCGCCGTCTTGGCCCTCTCCCGGGCTTCCGGCTGGACCGGTCTCCCC
CCGAGGTTGTCGTCATCGCCCCTCCATCTCAACGGTCCCGACGCTGGCGACAACGGCTGGGCCGGCTTGCAGCTA
CCGGAGGCCGAGGCCGGTGCCGGCGATGGCTTGTATCTGCTGGGCGTCGGCAAGGCTGACATCACGGGCCCTGTT
GTCGAGCTCAATCTGATGGGGTATGCCGACTTTACCCAGATGGGCTCCGGCTTACGACAACGCCTGTACTCGCGC
GCCTTCATCGTCGGTGACGTGGCCCGACCCCTGGACCGCTTTGTCTACCTCGTTCTCGACATCCAGTCCGGTGAT
ACCGCCGTCCGGTACGGCGTCCTCCGGGGTCTCTCCCGGCTCGGGCCGCGTTACAGCATGTACCGCCATGACAAC
GTGGCCGTCACGGCGACACACTCTCACTCCGGGCCCGGTGCCTGGCTCAACTACTTGCTTCCGCAGATCCCCAGC
CGCGGCTTCGACCGCCAGAGCTTTCAAGCCATCGTCGACGGCTGTCTGCTGTCGATTCGTCGTGCTCACGAGAGC
CTGGCTCCCGGTGAGCTGACCGTCGGCTCTACCAAGCTCGTCGGCGCCGGCATCAACCGTAGTCTCTTCTCCTAC
ATGGCCAATCCCGAGGCCGAGCGGGCGCGGTACAACATCAGCGCTCAAGACGATGGTTCCGTCGATACTGACATG
ACCATGTTGTCTTTCCGTCGGGCCTCGGATCGTCGCAACATTGGCCTGCTGACATGGTTCCCTACCCACGGCACG
TCGATGCAGGCCAACAACACGCTCATCTCTGGCGATAACAAGGGTGTTGCTGCCGATATGCTCGAAAAGGCACTG
AGGGACGACGATGCTACCGACTCGGACTTTGTAGCCGGCTTCTCCCAGGCCAATATGGGCGACGTCAGTCCCAAT
GTCCTCGGCGCCTGGTGTCAGGACGGCTCTGGCCAGCGCTGTCGTCTCGAAGACAGCACCTGCGCCGACGGCCGG
GGAAGCCTGTGCCGCGCTCGGGGTCCGGGCCGGACGACGGACGATCACGGGGCCTCGTCGTGTCTCGAGATCGGA
CGGAGGCAGTTCCGGGCCGCCCTCGACTTATACCGTCGTCTGGACCGACAGCCGGCCAACGTCCGGGGCGAGGGC
GTCAAGGCCTTTCACCGCTTCCACGACATGGCTGGCTTCTCCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACC
TGCGCCGCTGCGCTGGGATACTCGTTCGGCGCCGGAACGTGGGACGAGCCGGGCTCGTTCGATCTTGTGCAGCAC
CTGTCGGCCAAGTCCAAGTCTTCGTTTCTGTGGCCTCTCATCAGTTGGCTGATCCGGCATCCGACGCCCGAGCAG
AGCCGCTGCCAAGAGCCCAAGACGATCCTGCTGGACGTGGGCGACAAGGGCTTCCCGTACGCGTGGACGCCCAAC
GTGGTCGATGTGCAGACGCTGCGAGTTGGCCAGCTGCTCGTCATTGTGAGCCCGGGAGAGGCTACCACCATGGCT
GGCAGGCGGTGGAAGCAAGCTGTCGCTGACGAGGCGAGGAAGACGCTGGCTGATGAGTTGGAGGGGAGGGAGCCG
GTTGTTGTGCTGGGAGCGCCGAGTAACAGTTATACTCATTACATCACGACGGAAGAGGAGTATGGGTGAGTTGAC
TTTGTTTGTCTTGACGCCACCGTTACTCACATCTCTCGTCAGCGTGCAGCGATATGAGGGCGCTTCGACCCTCTA
CGGACGGCATACGCTGGCGGCGCACATGGACCGCAGCGTGGCGTCCGTCGCCTACCTCCGATCATCGTTATTGCC
GTCCTCGCCGCCTCCAGACCGCGTCTTCCTCCCGCAGCCGGAGCCGCCGGACAACAGCAACCGGTCGTGGAGCCT
GATCGCGGGCGTCGTCTACGATCGGGCCGGACGCAATCGACGCTTCGGCGACGTGACGGTCGATGTCAAACGCAA
GCATTTCCAGAGAGGCGACGTCGTCTCCGCCACCTTTGTCGGCGCCAACCCGCGCAACAACCTGCGGCTGGAGCA
GACGTACGCGGCCGTCGAGAGGCGACAGACGTCTCCGGCGCTGCAGACTCGCTGGAAAGTGGCTCTCTCCTCTGG
CGGACACCAGGCCTTGCTGTCTTCTCCCCCCGGCGGAGGAGGAGGGACGTCATCGTGGCGGACGATCCGGGACGA
TTCCGACTGGGCGCTTACCTTTCACTGGCGGAGGAAGAGCGCGCTGCTGGGGACGAGCGAGGTGAGAGTCGAGTG
GGAGGTTGAAGACGACGTGCCGCCCGGGGAGTACAGGCTGAGGTATTTTGGCGATTACAAGTCTTTGGGGGGGAG
GATAGAGGGGTTTGAGGGCATGAGCGGGACGTTTTATGTTGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail