Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|179
Gene name
LocationContig_103:4560..6217
Strand+
Gene length (bp)1657
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 2.0E-98 193 441
PF10348 DUF2427 Domain of unknown function (DUF2427) 8.3E-20 1 76

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 1 443 2.0E-67
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 177 441 8.0E-55

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 28 47 19
3 60 82 22
4 188 210 22
5 217 239 22
6 298 320 22
7 356 375 19
8 390 412 22
9 425 442 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|179
MLVCWVLVLPITVMLSLAGSRFTLMSQYWFLALNALGLVFGIIYNAQTPDLYPNNAHGKIGWLITMVASAQVLLT
LAGWAGRLWRQGYLPLSSKQLVTRDFISDCSHSDSPQSPNSIHEASAKSNHQPPYSSVPDHDDYGAFSANSPDDH
MGQDGFDGTAHASPPLPSSPMDKLWRCLAIISKVIDRIILPFGFVAITSGLATFGRLFEGNEVFSGLAHWIKGGV
FFWLGLFTLGRWTGSFGDLGWAWNLPPNTSQRTWRPSAEWVESALIFFYGSTNIFLEHLGSESGVWSSQDLEHIA
VTILFIGGGLCGILIESATVRRLLNTTVSKKAVVRSGPDDGGEAQRHTLVTPSYEVSLNPLPALIILLLGIIMSA
HHQSSGMAVQIHRQWGLLLSGASFARCMTYILIFLRPPRSTLPSRPPTELLTAFGLITGGIVFMASVF*
Coding >Ophun1|179
ATGCTGGTCTGCTGGGTCCTCGTCTTGCCCATCACTGTCATGCTGTCGCTGGCCGGCTCTCGGTTCACGTTAATG
TCGCAATATTGGTTCCTAGCTTTAAACGCGCTAGGTCTCGTTTTTGGAATCATCTACAACGCGCAGACGCCGGAT
CTGTATCCAAACAATGCCCACGGAAAGATCGGCTGGCTTATTACTATGGTCGCCTCTGCCCAAGTTCTCCTCACT
CTGGCGGGTTGGGCGGGCAGACTATGGAGACAAGGGTATCTCCCGCTGTCGAGCAAACAACTCGTCACCAGGGAC
TTCATCTCGGATTGCTCTCACAGCGACAGCCCGCAATCGCCCAACAGTATTCACGAGGCTTCGGCAAAGTCTAAT
CATCAGCCTCCGTATTCTTCCGTTCCAGACCATGACGACTATGGCGCCTTTTCGGCGAACAGTCCCGATGATCAC
ATGGGGCAGGATGGATTTGACGGGACAGCCCATGCGTCGCCCCCCCTACCAAGTTCCCCAATGGATAAACTGTGG
CGGTGCCTTGCAATAATTTCTAAAGTAATTGACCGCATCATTCTGCCTTTTGGCTTTGTTGCAATCACCAGTGGT
CTTGCCACGTTTGGTCGGCTCTTCGAAGGCAATGAAGTTTTCAGTGGGCTCGCTCACTGGATAAAAGGCGGCGTT
TTCTTTTGGCTAGGCCTCTTCACCCTAGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTC
CCTCCAAACACCAGTCAGCGAACGTGGCGCCCGTCAGCTGAGTGGGTGGAGAGCGCTCTCATCTTCTTCTACGGT
TCTACCAACATATTCCTTGAGCATCTTGGCTCTGAGAGTGGAGTATGGAGCTCTCAGGATCTCGAACACATCGCC
GTCACTATTCTGTTCATAGGCGGTGGCTTGTGCGGTATACTCATTGAGTCTGCCACAGTTCGAAGGCTACTCAAC
ACCACGGTATCGAAAAAAGCCGTTGTCAGATCAGGACCAGATGACGGTGGAGAGGCACAGCGACACACTCTTGTC
ACGCCCTCCTATGAGGTGTCTCTAAATCCACTACCAGCACTTATCATTCTCCTGTTGGGAATCATCATGAGCGCC
CACCATCAGTCATCCGGAATGGCAGTACAGATTCACAGGCAATGGGGTCTCCTGTTATCAGGTGCTTCGTTCGCT
CGTTGCATGACCTACATCCTCATTTTCCTACGACCACCCAGGTCGACTCTACCCTCCCGGCCTCCAACGGAGCTC
TTGACGGCGTTTGGGCTCATCACTGGTGGCATCGTCTTCATGGCAAGTGTGTTTTGA
Transcript >Ophun1|179
ATGCTGGTCTGCTGGGTCCTCGTCTTGCCCATCACTGTCATGCTGTCGCTGGCCGGCTCTCGGTTCACGTTAATG
TCGCAATATTGGTTCCTAGCTTTAAACGCGCTAGGTCTCGTTTTTGGAATCATCTACAACGCGCAGACGCCGGAT
CTGTATCCAAACAATGCCCACGGAAAGATCGGCTGGCTTATTACTATGGTCGCCTCTGCCCAAGTTCTCCTCACT
CTGGCGGGTTGGGCGGGCAGACTATGGAGACAAGGGTATCTCCCGCTGTCGAGCAAACAACTCGTCACCAGGGAC
TTCATCTCGGATTGCTCTCACAGCGACAGCCCGCAATCGCCCAACAGTATTCACGAGGCTTCGGCAAAGTCTAAT
CATCAGCCTCCGTATTCTTCCGTTCCAGACCATGACGACTATGGCGCCTTTTCGGCGAACAGTCCCGATGATCAC
ATGGGGCAGGATGGATTTGACGGGACAGCCCATGCGTCGCCCCCCCTACCAAGTTCCCCAATGGATAAACTGTGG
CGGTGCCTTGCAATAATTTCTAAAGTAATTGACCGCATCATTCTGCCTTTTGGCTTTGTTGCAATCACCAGTGGT
CTTGCCACGTTTGGTCGGCTCTTCGAAGGCAATGAAGTTTTCAGTGGGCTCGCTCACTGGATAAAAGGCGGCGTT
TTCTTTTGGCTAGGCCTCTTCACCCTAGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTC
CCTCCAAACACCAGTCAGCGAACGTGGCGCCCGTCAGCTGAGTGGGTGGAGAGCGCTCTCATCTTCTTCTACGGT
TCTACCAACATATTCCTTGAGCATCTTGGCTCTGAGAGTGGAGTATGGAGCTCTCAGGATCTCGAACACATCGCC
GTCACTATTCTGTTCATAGGCGGTGGCTTGTGCGGTATACTCATTGAGTCTGCCACAGTTCGAAGGCTACTCAAC
ACCACGGTATCGAAAAAAGCCGTTGTCAGATCAGGACCAGATGACGGTGGAGAGGCACAGCGACACACTCTTGTC
ACGCCCTCCTATGAGGTGTCTCTAAATCCACTACCAGCACTTATCATTCTCCTGTTGGGAATCATCATGAGCGCC
CACCATCAGTCATCCGGAATGGCAGTACAGATTCACAGGCAATGGGGTCTCCTGTTATCAGGTGCTTCGTTCGCT
CGTTGCATGACCTACATCCTCATTTTCCTACGACCACCCAGGTCGACTCTACCCTCCCGGCCTCCAACGGAGCTC
TTGACGGCGTTTGGGCTCATCACTGGTGGCATCGTCTTCATGGCAAGTGTGTTTTGA
Gene >Ophun1|179
ATGCTGGTCTGCTGGGTCCTCGTCTTGCCCATCAGTACGTGACACAACCTGGCTGTCGAACATGCCAATTACCGT
TCTTTTCTCACCAAGACTCATTAGCTGTCATGCTGTCGCTGGCCGGCTCTCGGTTCACGTTAATGTCGCAATATT
GGTTCCTAGCTTTAAACGCGCTAGGTCTCGTTTTTGGAATCATCTACAACGCGCAGACGCCGGATCTGTATCCAA
ACAATGCCCACGGAAAGATCGGCTGGCTTATTACTATGGTCGCCTCTGCCCAAGTTCTCCTCACTCTGGCGGGTT
GGGCGGGCAGACTATGGAGACAAGGGTATCTCCCGCTGTCGAGCAAACAACTCGTCACCAGGGACTTCATCTCGG
ATTGCTCTCACAGCGACAGCCCGCAATCGCCCAACAGTATTCACGAGGCTTCGGCAAAGTCTAATCATCAGCCTC
CGTATTCTTCCGTTCCAGACCATGACGACTATGGCGCCTTTTCGGCGAACAGTCCCGATGATCACATGGGGCAGG
ATGGATTTGACGGGACAGCCCATGCGTCGCCCCCCCTACCAAGTTCCCCAATGGATAAACTGTGGCGGTGCCTTG
CAATAATTTCTAAAGTAATTGACCGCATCATTCTGCCTTTTGGCTTTGTTGCAATCACCAGTGGTCTTGCCACGT
TTGGTCGGCTCTTCGTACGTTGGTGTCTCGTCAACCTCCAGCCGGCGGCTCCAAGCTTCCTAGCTAATGCCATGC
AATAGGAAGGCAATGAAGTTTTCAGTGGGCTCGCTCACTGGATAAAAGGCGGCGTTTTCTTTTGGCTAGGCCTCT
TCACCCTAGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTCCCTCCAAACACCAGTCAGC
GAACGTGGCGCCCGTCAGCTGAGTGGGTGGAGAGCGCTCTCATCTTCTTCTACGGTTCTACCAACATATTCCTTG
AGCATCTTGGCTCTGAGAGTGGAGTATGGAGCTCTCAGGATCTCGAACACATCGCCGTCACTATTCTGTTCATAG
GCGGTGGCTTGGTAGGCGTCTTCTTGTCTTCAAAACCAGATCACTGACATCGATACTTGTCAGTGCGGTATACTC
ATTGAGTCTGCCACAGTTCGAAGGCTACTCAACACCACGGTATCGAAAAAAGCCGTTGTCAGATCAGGACCAGAT
GACGGTGGAGAGGCACAGCGACACACTCTTGTCACGCCCTCCTATGAGGTGTCTCTAAATCCACTACCAGCACTT
ATCATTCTCCTGTTGGGAATCATCATGAGCGCCCACCATCAGTCATCCGGAATGGCAGTACAGATTCACAGGCAA
TGGGGTCTCCTGTTATCAGGTGCTTCGTTCGCTCGTTGCATGACCTACATCCTCATTTTCCTACGACCACCCAGG
TCGACTCTACCCTCCCGGCCTCCAACGGAGCTCTTGACGGCGTTTGGGCTCATCACTGGTGGCATCGTCTTCATG
GCAAGTGTAGGTTTACGCGAGCCAATGCTTGTTTTGACATTTCTAATGTTGTGCTTACAATGTATCCAGAGCTCC
GACACAGTCCAAAGCATGGACTATTATAACCTAGATTCTATGTTTGTATTCACTTTAACCTCGGGATTTGTAGGT
GTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail