Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1786
Gene name
LocationContig_179:9140..9774
Strand+
Gene length (bp)634
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999745

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1797
Ophiocordyceps australis map64 (Brazil) OphauB2|5259
Ophiocordyceps camponoti-floridani Ophcf2|02109
Ophiocordyceps camponoti-rufipedis Ophun1|1786 (this protein)
Ophiocordyceps kimflemingae Ophio5|3921
Ophiocordyceps subramaniannii Hirsu2|5108

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1786
MKLLLPLTLLATAAGVSAQSEKCDADYIVQACLKSENAKVQMCPGADWDCLCAAYNAVATCYNNCPDNPSAPSAR
QAASSNCQQASLYGTKAKAPKTTSMSGSSTSDMTATATASDSASSTDGSSGSNRAATSFTTSTARPSSTGAASTL
SGSAGGLFIAVAGVLAALL*
Coding >Ophun1|1786
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCTACCGCCGCCGGCGTCTCTGCCCAGAGCGAAAAGTGTGATGCC
GACTACATCGTACAAGCCTGCCTGAAGTCGGAGAATGCAAAGGTCCAGATGTGCCCTGGTGCCGACTGGGACTGC
CTCTGCGCCGCCTACAACGCCGTGGCCACATGCTACAACAACTGCCCCGACAACCCCAGCGCCCCCTCGGCTCGT
CAAGCCGCCAGCAGCAACTGCCAGCAGGCCTCGCTGTACGGCACCAAGGCCAAGGCCCCCAAGACGACCTCCATG
TCCGGCTCGTCCACCTCTGACATGACCGCCACCGCCACCGCTTCCGACTCTGCCTCTTCCACCGACGGCTCCAGC
GGCTCCAACCGAGCCGCCACCTCCTTCACCACTAGCACCGCCAGGCCCTCCAGCACCGGTGCCGCCTCTACCCTG
TCGGGCAGCGCCGGCGGCCTCTTCATTGCTGTTGCCGGTGTTCTGGCTGCTCTCCTATAG
Transcript >Ophun1|1786
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCTACCGCCGCCGGCGTCTCTGCCCAGAGCGAAAAGTGTGATGCC
GACTACATCGTACAAGCCTGCCTGAAGTCGGAGAATGCAAAGGTCCAGATGTGCCCTGGTGCCGACTGGGACTGC
CTCTGCGCCGCCTACAACGCCGTGGCCACATGCTACAACAACTGCCCCGACAACCCCAGCGCCCCCTCGGCTCGT
CAAGCCGCCAGCAGCAACTGCCAGCAGGCCTCGCTGTACGGCACCAAGGCCAAGGCCCCCAAGACGACCTCCATG
TCCGGCTCGTCCACCTCTGACATGACCGCCACCGCCACCGCTTCCGACTCTGCCTCTTCCACCGACGGCTCCAGC
GGCTCCAACCGAGCCGCCACCTCCTTCACCACTAGCACCGCCAGGCCCTCCAGCACCGGTGCCGCCTCTACCCTG
TCGGGCAGCGCCGGCGGCCTCTTCATTGCTGTTGCCGGTGTTCTGGCTGCTCTCCTATAG
Gene >Ophun1|1786
ATGAAGCTGCTGCTGCCTCTCACTCTCCTCGCTACCGCCGCCGGCGTCTCTGCCCAGAGCGAAAAGTGTGATGCC
GACTACATCGTACAAGCCTGCCTGAAGTCGGAGAATGCAAAGGTATCAACGTCTTCACCTACCCATCACTGTCAA
TCTCCTGTTCTGGCTGACACTCTCGCCCTTTAGGTCCAGATGTGCCCTGGTGCCGACTGGGACTGCCTCTGCGCC
GCCTACAACGCCGTGGCCACGTACGTTCTCCCTCCTCTTACACCTATCCCCTATACACCTACTTACACGCGAATC
CAGATGCTACAACAACTGCCCCGACAACCCCAGCGCCCCCTCGGCTCGTCAAGCCGCCAGCAGCAACTGCCAGCA
GGCCTCGCTGTACGGCACCAAGGCCAAGGCCCCCAAGACGACCTCCATGTCCGGCTCGTCCACCTCTGACATGAC
CGCCACCGCCACCGCTTCCGACTCTGCCTCTTCCACCGACGGCTCCAGCGGCTCCAACCGAGCCGCCACCTCCTT
CACCACTAGCACCGCCAGGCCCTCCAGCACCGGTGCCGCCTCTACCCTGTCGGGCAGCGCCGGCGGCCTCTTCAT
TGCTGTTGCCGGTGTTCTGGCTGCTCTCCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail