Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1777
Gene name
LocationContig_178:26712..28570
Strand+
Gene length (bp)1858
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 7.8E-23 44 158
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.1E-05 420 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 38 162 2.0E-42
sp|Q5R9L3|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1 43 161 1.0E-21
sp|Q9UN86|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2 43 161 1.0E-21
sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1 43 161 3.0E-19
sp|Q5RB87|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1 43 161 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 38 162 2.0E-42
sp|Q5R9L3|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1 43 161 1.0E-21
sp|Q9UN86|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2 43 161 1.0E-21
sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1 43 161 3.0E-19
sp|Q5RB87|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1 43 161 3.0E-19
sp|Q32LC7|G3BP1_BOVIN Ras GTPase-activating protein-binding protein 1 OS=Bos taurus GN=G3BP PE=2 SV=1 43 161 3.0E-19
sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding protein 1 OS=Mus musculus GN=G3bp1 PE=1 SV=1 43 161 6.0E-19
sp|Q9C7F5|NTF2_ARATH Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=1 SV=1 36 157 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1777
MATNGNFAHQEQYKAADQYPVAAADTTSAASASGNSNLSKDEVGWFFVEQYYTTLSKSPEKLHLFYGKRSQFVQG
LEAEVANVSVGRQVIQERIKQLDFQDCKVRVSNVDSQASFDNIVIQVIGETSNKGAEPKKFVQTFVLAQQPSGYF
VLNDILRYIKEEDDDDPAVTAAVEAPVNEDVAPAATISTETAPEGELTDKEASKDESSNSLNASVVNKKLEEAVE
AEKTINGGDVAAVGAAEPGQTSDSQSAIKTEATPASDPHAAAQELAEEDAKEPEKPKDPSPTPVSQPMPPPPEPA
APAEPPAPPKPMTWASRAAAAAGPRPVVPLPKTATSPASTQSRTPVPAPAAPAATTTATAAATTTPTQQPSTAAA
AVTAPAENMGKESSGWQTAGADWKRQNRPQSMSGNFAEKEGTMGYVKYVTDKVQDTDLRNALTAHGELTYFDINR
QKNCAFVEYKTVEGYQAAVSANPHVVNGENIVVEPRRPKATAYGGSNYGSGRGSLSGRGRGGGYDGARGGGQGNS
RGNFSGQSRGRGGMPRGRGGPQVSNA*
Coding >Ophun1|1777
ATGGCGACGAACGGGAATTTCGCCCATCAGGAGCAGTACAAGGCTGCTGACCAGTACCCGGTTGCCGCTGCCGAT
ACCACATCTGCCGCTTCTGCTTCGGGGAACAGCAATCTCTCCAAGGATGAGGTCGGATGGTTCTTCGTCGAGCAG
TACTACACCACCCTCAGCAAGTCTCCCGAGAAACTTCACCTCTTTTACGGCAAGCGCTCGCAATTTGTTCAGGGC
CTAGAGGCCGAAGTCGCCAACGTGTCTGTTGGCCGTCAGGTTATCCAGGAGCGTATCAAGCAGCTGGACTTTCAG
GACTGCAAAGTCCGGGTCTCCAACGTTGACTCGCAGGCTTCCTTCGACAACATTGTCATCCAAGTCATCGGCGAG
ACGTCCAACAAGGGCGCCGAGCCCAAGAAATTCGTCCAGACCTTTGTCCTCGCCCAGCAGCCTTCCGGCTACTTT
GTCCTCAACGACATCCTGCGGTACATCAAGGAGGAGGATGACGACGACCCCGCCGTGACTGCTGCCGTCGAGGCT
CCGGTCAACGAGGATGTGGCACCCGCTGCCACCATCTCGACGGAGACTGCGCCCGAAGGCGAGCTCACGGATAAG
GAGGCCTCCAAGGACGAGTCTTCCAACAGCCTCAACGCCAGCGTCGTCAACAAGAAGCTCGAGGAGGCTGTCGAG
GCCGAGAAGACGATCAATGGAGGCGACGTCGCAGCCGTTGGTGCCGCCGAGCCCGGCCAGACATCGGACAGCCAG
AGCGCCATCAAGACCGAGGCTACTCCGGCTTCGGACCCGCACGCGGCCGCCCAGGAGCTCGCCGAGGAAGACGCC
AAGGAACCCGAGAAACCCAAGGACCCGAGCCCGACGCCCGTGTCGCAACCCATGCCGCCCCCGCCCGAGCCTGCC
GCTCCCGCTGAGCCTCCGGCGCCTCCCAAGCCCATGACGTGGGCCAGTCGTGCGGCGGCTGCTGCCGGGCCCAGG
CCCGTGGTGCCCCTTCCAAAGACGGCCACGTCGCCGGCCTCGACGCAGAGCCGGACACCGGTCCCGGCCCCGGCG
GCTCCCGCAGCTACGACAACGGCGACGGCAGCGGCGACGACGACTCCGACTCAGCAGCCGAGCACGGCCGCGGCC
GCGGTCACGGCCCCTGCCGAAAACATGGGCAAGGAATCATCGGGATGGCAGACGGCGGGTGCTGACTGGAAACGT
CAGAACCGACCGCAGTCCATGTCCGGCAACTTCGCGGAGAAAGAGGGTACCATGGGTTACGTCAAGTACGTGACG
GACAAGGTTCAGGATACAGACCTCCGGAACGCCCTGACGGCTCACGGCGAGCTGACTTACTTTGACATTAACCGC
CAGAAGAATTGCGCGTTTGTAGAGTATAAGACGGTCGAGGGCTACCAAGCCGCAGTCTCGGCCAATCCGCACGTG
GTGAACGGTGAGAATATCGTGGTGGAGCCCCGACGGCCCAAGGCGACGGCCTATGGAGGTAGCAACTACGGGTCC
GGTCGAGGCAGTCTTTCCGGGCGAGGCCGAGGGGGCGGCTACGACGGGGCCCGAGGCGGAGGACAGGGCAACTCT
CGCGGCAACTTTTCCGGTCAGAGTCGAGGACGAGGCGGCATGCCTCGTGGACGCGGGGGTCCGCAGGTCAGCAAT
GCCTAG
Transcript >Ophun1|1777
ATGGCGACGAACGGGAATTTCGCCCATCAGGAGCAGTACAAGGCTGCTGACCAGTACCCGGTTGCCGCTGCCGAT
ACCACATCTGCCGCTTCTGCTTCGGGGAACAGCAATCTCTCCAAGGATGAGGTCGGATGGTTCTTCGTCGAGCAG
TACTACACCACCCTCAGCAAGTCTCCCGAGAAACTTCACCTCTTTTACGGCAAGCGCTCGCAATTTGTTCAGGGC
CTAGAGGCCGAAGTCGCCAACGTGTCTGTTGGCCGTCAGGTTATCCAGGAGCGTATCAAGCAGCTGGACTTTCAG
GACTGCAAAGTCCGGGTCTCCAACGTTGACTCGCAGGCTTCCTTCGACAACATTGTCATCCAAGTCATCGGCGAG
ACGTCCAACAAGGGCGCCGAGCCCAAGAAATTCGTCCAGACCTTTGTCCTCGCCCAGCAGCCTTCCGGCTACTTT
GTCCTCAACGACATCCTGCGGTACATCAAGGAGGAGGATGACGACGACCCCGCCGTGACTGCTGCCGTCGAGGCT
CCGGTCAACGAGGATGTGGCACCCGCTGCCACCATCTCGACGGAGACTGCGCCCGAAGGCGAGCTCACGGATAAG
GAGGCCTCCAAGGACGAGTCTTCCAACAGCCTCAACGCCAGCGTCGTCAACAAGAAGCTCGAGGAGGCTGTCGAG
GCCGAGAAGACGATCAATGGAGGCGACGTCGCAGCCGTTGGTGCCGCCGAGCCCGGCCAGACATCGGACAGCCAG
AGCGCCATCAAGACCGAGGCTACTCCGGCTTCGGACCCGCACGCGGCCGCCCAGGAGCTCGCCGAGGAAGACGCC
AAGGAACCCGAGAAACCCAAGGACCCGAGCCCGACGCCCGTGTCGCAACCCATGCCGCCCCCGCCCGAGCCTGCC
GCTCCCGCTGAGCCTCCGGCGCCTCCCAAGCCCATGACGTGGGCCAGTCGTGCGGCGGCTGCTGCCGGGCCCAGG
CCCGTGGTGCCCCTTCCAAAGACGGCCACGTCGCCGGCCTCGACGCAGAGCCGGACACCGGTCCCGGCCCCGGCG
GCTCCCGCAGCTACGACAACGGCGACGGCAGCGGCGACGACGACTCCGACTCAGCAGCCGAGCACGGCCGCGGCC
GCGGTCACGGCCCCTGCCGAAAACATGGGCAAGGAATCATCGGGATGGCAGACGGCGGGTGCTGACTGGAAACGT
CAGAACCGACCGCAGTCCATGTCCGGCAACTTCGCGGAGAAAGAGGGTACCATGGGTTACGTCAAGTACGTGACG
GACAAGGTTCAGGATACAGACCTCCGGAACGCCCTGACGGCTCACGGCGAGCTGACTTACTTTGACATTAACCGC
CAGAAGAATTGCGCGTTTGTAGAGTATAAGACGGTCGAGGGCTACCAAGCCGCAGTCTCGGCCAATCCGCACGTG
GTGAACGGTGAGAATATCGTGGTGGAGCCCCGACGGCCCAAGGCGACGGCCTATGGAGGTAGCAACTACGGGTCC
GGTCGAGGCAGTCTTTCCGGGCGAGGCCGAGGGGGCGGCTACGACGGGGCCCGAGGCGGAGGACAGGGCAACTCT
CGCGGCAACTTTTCCGGTCAGAGTCGAGGACGAGGCGGCATGCCTCGTGGACGCGGGGGTCCGCAGGTCAGCAAT
GCCTAG
Gene >Ophun1|1777
ATGGCGACGAACGGGAATTTCGCCCATCAGGAGCAGTACAAGGCTGCTGACCAGTACCCGGTTGCCGCTGCCGAT
ACCACATCTGCCGCTTCTGCTTCGGGGAACAGCAATCTCTCCAAGGATGAGGTCGGATGGTTCTTCGTCGAGCAG
TACTACACCACCCTCAGCAAGTCTCCCGAGAAACTTCACGTAAGTGCCGTCCAGCCCTCTGTCCTCCCCCCGGGG
GCGTCTGGGAAAGCTGACTGACATTTGAACCCACCAGCTCTTTTACGGCAAGCGCTCGCAATTTGTTCAGGGCCT
AGAGGCCGAAGTCGCCAACGTGTCTGTTGGCCGTCAGGTTTGTGCCTTTACTGTCCTGCCACCGTCTCCGTTCTG
CGCTGACTCTGCCATCGTCAACAGGTTATCCAGGAGCGTATCAAGCAGCTGGACTTTCAGGACTGCAAAGTCCGG
GTCTCCAACGTTGACTCGCAGGCTTCCTTCGACAACATTGTCATCCAAGTCATCGGCGAGACGTCCAACAAGGGC
GCCGAGCCCAAGAAATTCGTCCAGACCTTTGTCCTCGCCCAGCAGCCTTCCGGCTACTTTGTCCTCAACGACATC
CTGCGGTACATCAAGGAGGAGGATGACGACGACCCCGCCGTGACTGCTGCCGTCGAGGCTCCGGTCAACGAGGAT
GTGGCACCCGCTGCCACCATCTCGACGGAGACTGCGCCCGAAGGCGAGCTCACGGATAAGGAGGCCTCCAAGGAC
GAGTCTTCCAACAGCCTCAACGCCAGCGTCGTCAACAAGAAGCTCGAGGAGGCTGTCGAGGCCGAGAAGACGATC
AATGGAGGCGACGTCGCAGCCGTTGGTGCCGCCGAGCCCGGCCAGACATCGGACAGCCAGAGCGCCATCAAGACC
GAGGCTACTCCGGCTTCGGACCCGCACGCGGCCGCCCAGGAGCTCGCCGAGGAAGACGCCAAGGAACCCGAGAAA
CCCAAGGACCCGAGCCCGACGCCCGTGTCGCAACCCATGCCGCCCCCGCCCGAGCCTGCCGCTCCCGCTGAGCCT
CCGGCGCCTCCCAAGCCCATGACGTGGGCCAGTCGTGCGGCGGCTGCTGCCGGGCCCAGGCCCGTGGTGCCCCTT
CCAAAGACGGCCACGTCGCCGGCCTCGACGCAGAGCCGGACACCGGTCCCGGCCCCGGCGGCTCCCGCAGCTACG
ACAACGGCGACGGCAGCGGCGACGACGACTCCGACTCAGCAGCCGAGCACGGCCGCGGCCGCGGTCACGGCCCCT
GCCGAAAACATGGGCAAGGAATCATCGGGATGGCAGACGGCGGGTGCTGACTGGAAACGTCAGAACCGACCGCAG
TCCATGTCCGGCAACTTCGCGGAGAAAGAGGGTACCATGGGTTACGTCAAGTACGTGACGGACAAGGTTCAGGAT
ACAGACCTCCGGAACGCCCTGACGGCTCACGGCGAGCTGACTTACTTTGACATTAACCGCCAGAAGGTATAGTGC
CACCGCTGGGCGCTTCTTGGCCTGAGCCGTCTCCGCTGACCTGAGGCCCGTTGTCTAGAATTGCGCGTTTGTAGA
GTATAAGACGGTCGAGGGCTACCAAGCCGCAGTCTCGGCCAATCCGCACGTGGTGAACGGTGAGAATATCGTGGT
GGAGCCCCGACGGCCCAAGGCGACGGCCTATGGAGGTAGCAACTACGGGTCCGGTCGAGGCAGTCTTTCCGGGCG
AGGCCGAGGGGGCGGCTACGACGGGGCCCGAGGCGGAGGACAGGGCAACTCTCGCGGCAACTTTTCCGGTCAGAG
TCGAGGACGAGGCGGCATGCCTCGTGGACGCGGGGGTCCGCAGGTCAGCAATGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail